SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JCE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JCE5
Domain Number 1 Region: 443-641
Classification Level Classification E-value
Superfamily Kelch motif 1.12e-61
Family Kelch motif 0.0000088
Further Details:      
 
Domain Number 2 Region: 172-290
Classification Level Classification E-value
Superfamily POZ domain 3.26e-34
Family BTB/POZ domain 0.0025
Further Details:      
 
Domain Number 3 Region: 649-728
Classification Level Classification E-value
Superfamily Kelch motif 1.31e-23
Family Kelch motif 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3JCE5
Sequence length 731
Comment (tr|I3JCE5|I3JCE5_ORENI) Kelch like family member 4 {ECO:0000313|Ensembl:ENSONIP00000006535} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=KLHL4 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MSVSGKKEFDVKQILRLRWRWFSHSSQGSAGGGGGGVGGGGGYIQQDGLDHRGTPVQGRL
KSHSRERGVGGLRKTNSPVHSILAPTPGPTPVYVRAGHQSWHHQQSTIQGSQASEDSSKN
SSSPSTTRKDDTNTGQEDVKSSTEDPAELEARERITKHLLSKMNTNSSDEFFQATNHAEQ
TFRKMETYLQHKQLCDVLLIAGDHKIPAHRLVLSAVSDYFAAMFTSDVREAKQEEIKMEG
VDPEALRSLVHFAYTGVLELKEETIESLLAAACLLQLSQVIQVCCNFLMKQLHPSNCLGI
RSFADAQGCVDLLNVAHNYTMEHFLEVIQNQEFLLLPTAEIVKLLSSDDINVPDEETIFQ
ALMMWVRYDVQNRQQDLGVLLAYIRLPLLPPQLLADLENNKMFSDDLECQKLLMEAMKYH
LLPERRPMFQSPRTKPRKSTVGALYAVGGMDATKGSTTIEKYDLRTNTWVQVGVMNGRRL
QFGVAVIDNKLYVVGGRDGLKTSNMVECYNPVTKVWSTMPPMSTHRHGLGIAVLEGPMYA
VGGHDGWSYLNTVERWDPQARQWNYVASMSTPRSTMGVTALNGKLFAVGGRDGSSCLRSM
ECFDPHTNKWSMCAPMTKRRGGVGVATYNNFLYAVGGHDAPASNHCSRLSDCVERYDPKT
DTWTTVAPLSVPRDAVGVCLLGDRLYAVGGYDGQSYLNTVESYDAQNNEWTEEVPLNIGR
AGACVVVVKLP
Download sequence
Identical sequences I3JCE5
ENSONIP00000006535 ENSONIP00000006535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]