SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JCU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JCU8
Domain Number 1 Region: 9-171
Classification Level Classification E-value
Superfamily Hook domain 7.72e-38
Family Hook domain 0.0014
Further Details:      
 
Weak hits

Sequence:  I3JCU8
Domain Number - Region: 246-336
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0288
Family HBL-like 0.073
Further Details:      
 
Domain Number - Region: 863-959
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0549
Family HBL-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3JCU8
Sequence length 1388
Comment (tr|I3JCU8|I3JCU8_ORENI) Coiled-coil domain containing 88B {ECO:0000313|Ensembl:ENSONIP00000006688} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MESSIKEIIEEFMESALAQWVRHLSFITLSAQTQSARDRYLRLTNGIFLNEVMRVIDPNP
KVERLYNSERDDHMLRVQNFSILNRHLRAFYQEDLQQLILMPLPNVAILGQDPLTEAAVE
ELRRLLLLLLGSAVQCENKETFIQQIQSLDIETQAGIAGCIQQVTQDPRVVLPLQWEELV
ETEGADLQLVFSSMAKQIQSLLAQRDTQLERIAELCREREAQSDSTTGHLGGRNEESSQG
LLLQLADSKAKLRRLKQQLEDKGDQILDYKQEIETMEEQLQKLQKENRSLQGDVRGMRAL
RDELDCARERAARSEQLQTELQSCKHRLRSLERYISTTKYIVFKKNVMQETKTLLEEQLA
DARARCSSLRELERDNLVLRQRIMEVEAERDTERQRVDELLEMNMSLEADLRHSSSGGSV
LAPVVALPQRFLQSELESDEEKPLSVEVGEASTLRLLGAEQENAELRRRLEELQAQQEHM
KGNSDKKDKRKEEGMKMPDRVEEEGEGKKVVRGVQGSESCRGEGEGRVRMMEEKEKRGEV
IGTHREAGVGEEILHVQTGKDEPCNEVIQTNRRGEAEGGQKEREKQEKESEPKKEKTELP
ISSEIQKQSASPDMELLTKRLQEAQEEAERQTNLAQDLRSKLGEQSKKTWEAEQRLVLVE
AELQRLKKAGESLVEARRQIEVLQSEGLVMEEELCRLRSQAELHRMQTTIIATLEGERAT
LERERDMLRSTLDTMRTAQRKSDQLELTTQTLRAELERQGRSLETSRRREEELEAELREA
TLEAESLARARDQALLEASRLEQEKEVCQSELDGQRKEGRQREREAGRLRQQLESTTLAL
EHSNQRACALDAEHRRVCQQLSESKELCAQLQDLEKELSFRLSSMEEGKQQLQEQYAEAQ
AKISALSQDLTREQARSEKLATEVEHLSQKLQRSEAERQSAKDSLHQSQERIESLSQRLK
KTESLQLETRRESAEVKSAPNSNSESTDKQDMSPSDQSPEAAKGCDLSTTRDHFTGEAER
HLSERVIELEKEKAVAAAEHEALLTRLSQSQEACKHLEEQLEALRRNSLSLQDSCTRLQT
LNTQLQVEQASLSSQHAALLARCSESEARCATLEAESKVWAREREESVARMDALRRDHER
MTALQQRQEVELEELVEKHSQLRNNNRSLEAQHRELEGRYKELLDGKTQLEEREREMKTE
REKMETEAQRRLERERELERLKEDNDRLQAHQKEWLASQAELLAQGSVLRAELNASQLER
TRLEGELSALKETHQSLDLSNARLTSQYQLLTQLKGNMEEENRHLAEQNQSLLRENRALL
EQSLERRDQHYSQQREYQEKLSELRREKQKLVEKIMDQYRVLEPSMPSPASKAKKSNWIA
DRMKKLIK
Download sequence
Identical sequences I3JCU8
ENSONIP00000006688 ENSONIP00000006688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]