SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JF74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I3JF74
Domain Number - Region: 189-224
Classification Level Classification E-value
Superfamily UBA-like 0.0383
Family UBA domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3JF74
Sequence length 226
Comment (tr|I3JF74|I3JF74_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000007515} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
LVWLRKRQTVRAMEVKNPSPKEFKCALSSVLASCNESESEGSVPELEELEPLRPSEPQNL
LLAKSISSADEGLNRPKQSRSEKKARKAMSKLGLKPVHGVTRITIRKSKSILFVISRPDV
FKSPVSDIYIVFGEAKIEDLSQQAHKAAAEKFKVPVTSSPLAPPVPPSLTIKEESEEEEE
EVDEGGLEQRDIELVMAQANVSRAKAVRALKHNKNDIVNAIMELTM
Download sequence
Identical sequences I3JF74
ENSONIP00000007515 ENSONIP00000007515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]