SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JFI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JFI9
Domain Number 1 Region: 250-492
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.43e-86
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 153-255
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000314
Family Hepsin, N-terminal domain 0.024
Further Details:      
 
Domain Number 3 Region: 107-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000772
Family LDL receptor-like module 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3JFI9
Sequence length 495
Comment (tr|I3JFI9|I3JFI9_ORENI) Transmembrane protease, serine 4a {ECO:0000313|Ensembl:ENSONIP00000007630} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100694080 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MYGRCDQSQVDKEIGSSVSHTNIPTQSKTRHNREEQGTTAAQLPEETSRPLNPTNPGPRP
GRHRRPMTAPNTPREKRAKIKKVLITTLTVLLILGILAIAAYFIKNLIESKYFFCTRSVK
FIPLDKTCDGHIDCAGAEDEITCMTTFKVNTTFPVRLQSNDQVLQVYSPDSGWRTVCADD
WTQAHTQTACTQLGYTMKPTSKNILVSSLMSPMKTGPFTAVRPGTSNTPIQQATADRSVC
NSGSVVSLSCSDCGKVGPEHRIVGGTDTSIDHWPWQVSLQRSGQHTCGGSLVSPRWVVTA
AHCFTGNNRELRQWAVVSGQTNIITLGGSSVDRVIVNGDYNAETNDYDIALMRLTRPITV
SDIRRPVCLPPKDYIITAGTYMTVTGWGYQRENGAVSDILQEANVPLIAQSACSSYTLYG
SAITNRMLCAGFPEGKVDACQGDSGGPLVHITESNWNLVGVVSWGVGCARKGKPGVYSNV
EMMLNWIQTVIEKHP
Download sequence
Identical sequences I3JFI9
ENSONIP00000007630 ENSONIP00000007630 XP_005455837.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]