SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JG35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JG35
Domain Number 1 Region: 35-161
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 4.58e-58
Family N-terminal domain of cbl (N-cbl) 0.000000261
Further Details:      
 
Domain Number 2 Region: 248-334
Classification Level Classification E-value
Superfamily SH2 domain 4.34e-48
Family SH2 domain 0.00000241
Further Details:      
 
Domain Number 3 Region: 340-420
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-41
Family RING finger domain, C3HC4 0.0000102
Further Details:      
 
Domain Number 4 Region: 163-247
Classification Level Classification E-value
Superfamily EF-hand 2.86e-37
Family EF-hand modules in multidomain proteins 0.00000793
Further Details:      
 
Domain Number 5 Region: 860-898
Classification Level Classification E-value
Superfamily UBA-like 0.0000188
Family UBA domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3JG35
Sequence length 911
Comment (tr|I3JG35|I3JG35_ORENI) Cbl proto-oncogene, E3 ubiquitin protein ligase {ECO:0000313|Ensembl:ENSONIP00000007826} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=cbl OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MAGNLKKGGGIIGMMKDAFQPHHHHLHSHHQPGAVDKKTVEKCWKLMDKVVRLCQNPKLA
LKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGDNEYFRVFMENLTKKTKQTISLFKEG
KERMYEENSQPRRNLTKLSLIFSHMLAELKAIFPNGLFQGDNFRITKADAAEFWRRAFGD
KTIVPWKVFRQSLHEFHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLLR
NWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQ
TIPHNKPLFQALIDGFREGFYLFPDGRTQNPDLTGLCEPSPQDHIKVTQEQYELYCEMGS
TFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESEGQGTGCPFCRCEIKGTEPIVVDPF
DPKDNSGGSSKSTFGAEGAPSPSYDDDDDDRLEDPHLIMSKLAGTKVERPPSPMSGTPQS
SLPPVPPRLDLLPHRPPNPPGASSPGVSSKAPSHHKDKPLPLPPALRDLPPPPPPDRPHT
AGAAPDGRLQRRPLPSTPGEPPRDKLPPTPPNRPLSDWTSRPVPKAPTSSSSSSSVSCVR
ELSNRHSLPLALPSSMDARSDSQNNSSLSLDHQLNFSTGVGQDYDNPRVKPSVSANAIYA
LANRASPARPAGGDEGHDSDDEYMIPSSRPVLPPIPTSLMGETPPIPRPPQSVFWPCRLI
LDDVPHSLQMYEAMFNAQPRSQQARDSDYSDLPPQPVSNGPRDHEADDGEEEENGYDFPK
PRLPLPPARRTLSEMVCAAAAFNRLSLDADAGAAASFPDPMEAPERPPKPLPRRINSERR
ASPVPPTPLGGGATGGEANPQISSEIEHLMSQGYTQHDIQKALMIAQNNIEMAKNILREF
VSIPSTAHILT
Download sequence
Identical sequences I3JG35
ENSONIP00000007826 ENSONIP00000007826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]