SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JGZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JGZ6
Domain Number 1 Region: 1165-1361
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.61e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000232
Further Details:      
 
Domain Number 2 Region: 947-1072
Classification Level Classification E-value
Superfamily PH domain-like 7.35e-29
Family Pleckstrin-homology domain (PH domain) 0.000012
Further Details:      
 
Domain Number 3 Region: 44-167
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-18
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3JGZ6
Sequence length 1983
Comment (tr|I3JGZ6|I3JGZ6_ORENI) Rho GTPase activating protein 21 {ECO:0000313|Ensembl:ENSONIP00000008137} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=ARHGAP21 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MMAARWSDSPQDNEERKHRAITPCGKAKQKDGRDQSEASAAASPGADDEPFSWPGPKTLR
LRRTSQGFGFTLRHFIVYPPESAVHNSLKDEENGSRGRQRNRLEPMDTIFVKQVKEGGPA
HGAGLCTGDRIVKVNGESIIGKTYSQVIALIQNSDALLELCVMPKDEDILQLAYSQDAYL
KGNEAYSGNAQNIPEPPPICYPRIEVKAAGMAQSSEPVTVTETPRGPVQGPGRRGGATEK
SYRVEIPVPPPPQQTSKSQTAVCVCNDNVRTVPPDQIERGSRVARAGPSHRTEENRYGPT
TDSGSARPRPLIPSVPGSAQLQYPSSHTTEMPVYSPSSTSRPGIYPDTLSPPGRASQDTF
STAISPSANHYSPSPTAPSTSPHQNIDWKNYTTYKDYIDAKRLHSYGCRTIQERLDTLRA
ASSSSSVYTQQRTTSPPVASQRGALESQVRRRSASNDRGVDTGSQGAAVTAPLRSASQER
LGGRAERTITTRNWPRSASQDALPFSTPTGVTKPRARSCDYLGQHPGELGGLLSGDRLGV
EDRLQLGQGEEARASRQGSGLRALPHLNRSLTGQEEEGQGFSNSPLAAPVFTKGTTDSAL
PSRTDGIVMRPSRLPVKNAISDASPALPSSKPMDPLKDQRANIMGNHMGYSSPLHLQLRS
RADSLKIESRSEAGLAARSSSCSGPSSKLPMQRQLQSADSSSTSNGAVTQKPKVKETSSS
TNSLVWTNGSLAEGVEGPDATVVVLRRDKISGTAHVRPPSYVIAVNDNQRGVTHKSPPLV
KAGSADAAMCWTSSDSYREMHLRRLGDTRQKSGSSNLDDSLDSIPFIDEPSSPSIDLESA
HIPASAVISGTPIITTVPASPPSPSPLIRRQLSHDQDSLRLTIIESDSGTKTERSKSYDE
GLDNYREEGRGRSMIPGLKSLMKAVDRSSDDSGSRRDSSSDVFCDATKEGLLHFKQLHTE
KAKRVGGGMRPWKQMYAVLRGNYLCLYKDKKEGQAHANCQAVDEPLPISIKSCLIDISYS
DTKRKNVLRLTTSDCEYLFQAEDREDMLAWIRVIQENSNLDEENADFTSHDLISRKIKEY
NTLMSPTGSKTEPSPRTSRQSLRQTLLGGKGETKATSPHSPKAEQERKNMHKDDTSPPKD
KGTWRKGIPGLMRKPFEKKPSPGVTFGVRLDDCPPAQTNKFVPLIVEVCCKLVEERGLEY
TGIYRVPGNNAAISNMQEELNNKGMNDIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNE
RYTDFIEANRIEDPVERLKVLKRLLHELPAHHYETLKFLSAHLKTVAENSEKNKMEPRNL
AIVFGPTLVRTTEDNMTHMVTHMPDQYKIVETLIQNYDWFFTEDGNGEPVTVSQEESAVE
SQPVPNIDHLLTNIGRTGTSQGEVSDSPTSDSAKSKGSSGKDQCSRDLLVSSIFAVASRK
RKKSREKPQPSSSDDDLDSVFLKKEILAQKPNQQTEAQGETRPSPNTKPSTKQQARTEER
KENGRTVELTPKAKREHRHSLFLREKITPRRSSPSPLPSPKISNSPNISYQTAPQGKSSL
SDPPSQLDENTSDLGTMSSGASVPRSRPKKWTAGVSPDLPAGVALGASAGASAGAEVSSI
TSDYSTTSSITFLTGAESSALSPELQGGEEADDERSELISEGRPMETDSESDFPVFAPGG
GSSQSTPCPTQSQEKAEAKGGSAIEGGTSPKLEARRLFPTHRMIECDTLSRRWSLKQKTD
SESSVEGAAGSGERSEGRAESSSRLSRVLEVMKKGRSTSSLSSSSRSESERSEPAWHLKI
TERLKFRLRTSADDMFTQKNRSPDGRSKKKNIRRRHTMGGQRDFAELAIINDWREQGGVD
QVAELSALDRLKPRCSSQDLSIRDWIAREQSRGSEQSRGSEPSVEVAPKAVPEDDHAEVH
EERPPERPPPPPPSDSPGAQPPAGEHINGRGLQSKNKGSLGDDAHPHKLSGAQVVRSRFY
QYL
Download sequence
Identical sequences I3JGZ6
ENSONIP00000008137 ENSONIP00000008137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]