SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JGZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JGZ8
Domain Number 1 Region: 170-411
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.13e-71
Family Nuclear receptor ligand-binding domain 0.00000000153
Further Details:      
 
Domain Number 2 Region: 57-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.87e-28
Family Nuclear receptor 0.00000855
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3JGZ8
Sequence length 416
Comment (tr|I3JGZ8|I3JGZ8_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000008139} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100697873 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MEPMSNKQDSNSSEGDEKGWPDVPKRKRKNSQCSVKSMSALSVSVPGYIPSYLEKDEPCV
VCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGCCIIDKITRNQCQLCRFKK
CISVGMAMDLVLDDSKRVAKRRLIEENREKRKKEEMMRMLQTRPEPDTAEWELIRMVTEA
HRHTNAQGSSWKQKRKFLPDDIGQGPMVPTSDGDKVDLEAFSEFTKIMTPAITRVVDFAK
KLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPDSETLTLNGEMAVKREQLKNGGLGV
VSDAIFDLGKSLAQFNLDDSEVALMQAVLLMSSDRSGLTSMEKIEQCQEAYLLAFEHYIN
YRKHNIPHFWPKLLMKVTDLRMIGACHASRFLHMKVECPNELFPPLFLEVFEDQEV
Download sequence
Identical sequences I3JGZ8
ENSONIP00000008139 ENSONIP00000008139 XP_005468631.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]