SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JH45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JH45
Domain Number 1 Region: 153-433
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.42e-71
Family Nuclear receptor ligand-binding domain 0.00000000354
Further Details:      
 
Domain Number 2 Region: 99-178
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-26
Family Nuclear receptor 0.0000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3JH45
Sequence length 464
Comment (tr|I3JH45|I3JH45_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000008188} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100698153 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MRTTFPYGLHGDSGQIMFDYMEFQVFGPGEIVDFYSTSSPSCMLQEQDQDLAAFFPELIE
SDWQEHRYSQSVESQSSSSSFSSDDLFTRPASPPPPPRTYKPCFVCQDKSSGYHYGVSAC
EGCKGFFRRSVQKNMVYTCHRDRNCIINKITRNRCQYCRLQRCFAVGMSKESVRNDRNKR
KGKKEAVKMTIMETYELTAELGLIVEKICRAHRETFPSLCQLGKYTTNSSSDHRIQLDLG
LWDKFSELATKCIIKVVEFAKQVPGFTGLTIADQITLLKAACLDILILRICTRYTPDQDT
MTFSDGLTLTRTQIHNAGFGPLTDQVFTFAGQLLPLEMDDTESGLLSAICLVSGDREDLE
EPSKVEVLQEPLLEALKIYSRKRRPSMPLMFPKALMKITDLRSISAKGAERVVTLKMEIP
GSMPPLIEEMLEDLQNLEKHQKSVTTQHTHAVSSQHMNSAGFLL
Download sequence
Identical sequences I3JH45
ENSONIP00000008188 ENSONIP00000008188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]