SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JI87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JI87
Domain Number 1 Region: 149-192,386-419
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000136
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 
Weak hits

Sequence:  I3JI87
Domain Number - Region: 460-505
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00759
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3JI87
Sequence length 667
Comment (tr|I3JI87|I3JI87_ORENI) CUB domain containing protein 1a {ECO:0000313|Ensembl:ENSONIP00000008581} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
CSRPQDVFSIEIVRRINCTTESCSGHIIQTDSNSIDALRFNRTFTWNLTAAAPKAFQIDF
TKTGLKQINPSEKCPDRHTYTLQAFQSTGNVAVETFCSRFTLGRINDKKGEKLNVKYVPW
LQNLYVSGAVHANFVALARISLTLPKGTSSSELLSPDYPESFPDDDIMGWYFRVPEKHRV
DVQFLNLTQPDCVKKEVAVEYHQKGRVTSVLGLNDTQPLQKQGDFLLTLRNCEMERAPAD
SPGLTFTLKVSASSPASTVSCKVDLSKTEGLSLNISTLTPTPDCVMKINSVKKDNITVTS
SFSYHNSVFILYTRLLIWVLKEEVTAVDCSSGKCPDPVSLLVPLLPFCLPAPLSRVTWIL
RPGRHGTVKLISPTGPLKQSLPGQLCDDSVTIDVAEENGAPIGTFCRDGAIQTVHIHTNV
SVTLWSSMNAKAPRSAVLNASFENEITERYIFTVFPKRDTPELVATPAWPAGMKASSTVS
WIVSVPPKMEAQLIFTKLSQPKCSNSHTNIRVQRMGSPEEDYSRREDEMAKSELTVSESF
YLNMSNCLPERGNFSVITMISLQKSKYLLLINILSVVAALLVIFVMVLVVVCVPNRKKKK
KKLNHEVSVYNPNGINFLPGYNGPPKTHEDDDAHVYTSIDDTLVYTHLFKKGADIGIYGE
TYQPFTG
Download sequence
Identical sequences I3JI87
ENSONIP00000008581 ENSONIP00000008581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]