SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JQG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JQG1
Domain Number 1 Region: 205-468
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-78
Family Nuclear receptor ligand-binding domain 0.00000000135
Further Details:      
 
Domain Number 2 Region: 100-185
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.65e-27
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3JQG1
Sequence length 469
Comment (tr|I3JQG1|I3JQG1_ORENI) Peroxisome proliferator-activated receptor alpha b {ECO:0000313|Ensembl:ENSONIP00000011105} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100709869 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MVDMETQYHPPSPLEDSVLGSPLCADDDFMGGMEQLQDISQSISDDALSSFGVPKYQSSS
NGSDGSTVLDALTPASSPSSVVYGVVASQEELSSSSTSLNLECRVCSDRASGYHYGVHAC
EGCKGFFRRTIRLKLEYDKCERRCKIQKKNRNKCQYCRFQKCLSVGMSHNAIRFGRMPQS
EKLKLKAEMVTVDKEVENPQLADQKTLAKHIYEAYLKNFNMNKAKARSILMGKTNTAPFV
IHDMETLQLAEQTLVAKMVGSVGAMKDKEVEVRIFHCCQCTSVETVTELTEFAKSVPGFS
NLDLNDQVTLLKYGVYEAIFAMLASSMNKDGLLVAYGSGFITREFLKSLRRPFSDMMEPK
FQFAMKFNALELDDSDLALFVAAIICCGDRPGLVNVAHIEAMQESIVQILQLHLLANHPD
DTFLFPRLLQKLADLRQLVTEHAQLVQEIKKTEDTSLHPLLQEIYRDMY
Download sequence
Identical sequences I3JQG1
XP_003443968.1.78416 XP_013126002.1.78416 XP_013126003.1.78416 XP_019217320.1.78416 ENSONIP00000011105 ENSONIP00000011105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]