SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JQZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JQZ3
Domain Number 1 Region: 336-598
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.08e-71
Family Nuclear receptor ligand-binding domain 0.000000000183
Further Details:      
 
Domain Number 2 Region: 263-341
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-27
Family Nuclear receptor 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3JQZ3
Sequence length 600
Comment (tr|I3JQZ3|I3JQZ3_ORENI) Nuclear receptor subfamily 4, group A, member 2a {ECO:0000313|Ensembl:ENSONIP00000011287} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=nr4a2 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MPCVQAQYGSSPQGASPASQSYSYHTAGEYSCDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYNTSYDVKPPCLYQMPHSGEQSSIKVEDVQMHSYHQQSHLPPQSEEMMAHSGPM
YFKPSSPHAPSTPNFQVQPNHMWEDPGSLHSFHQNYVAATSHMIDQRKNPVSRLSLFSFK
QSPPGTPVSSCQMRFDGPLHVSMNHDNPGAHRGPDGQSFAVPSAIRKQAGLAFPHSLQLS
HGHQLMDSQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYV
CLANKNCPVDKRRRNRCQFCRFQKCLVVGMVREVVRTDNLKGRRGRLPSKPKSPQEPSPP
SPPVSLISALVRAHVDSNPSMSALDYSRFQANPDYQMTGDNTQHIQQFYDLLTGSMEIIR
GWAEKIPGFSDLPKQDQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRG
FGEWVDAIVEFSSNLQSMNIDISAFSCIAALAMVTERHGLKEPKRVEDLQNKIVNCLKDQ
VTFNGGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Download sequence
Identical sequences I3JQZ3
ENSONIP00000011287 XP_005453065.1.78416 ENSONIP00000011287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]