SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JR45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JR45
Domain Number 1 Region: 1605-1686
Classification Level Classification E-value
Superfamily SMR domain-like 1.44e-17
Family Smr domain 0.0000615
Further Details:      
 
Domain Number 2 Region: 382-511
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000837
Family Nucleotide and nucleoside kinases 0.0052
Further Details:      
 
Domain Number 3 Region: 51-93
Classification Level Classification E-value
Superfamily UBA-like 0.00000000765
Family CUE domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3JR45
Sequence length 1686
Comment (tr|I3JR45|I3JR45_ORENI) NEDD4 binding protein 2 {ECO:0000313|Ensembl:ENSONIP00000011339} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MPRRKKNGQSPGRLPDGGPNERGNLGQSTGYPLQQGHGGGMSSNFPPNTVNDEIVRSMQE
MFSHLDPEVIYIVLSECDFKVEHAMDSLLELSVAAEDTVAAPPSVSGFERTAAALLAPQH
FSEPSQKPSSPPSSNPLTEELDLLVDQELETLAVQQDVGKEHHSSKYLSSGASLSSSFPP
PPLPQQALPELLQSSLDHGSREPSEHKSGASSPLDQLSTWEQKSTEGQQPVVDFTHLTTE
TSANTPKPALDLAASGRPSAFQVYKKQELTHTLSENAGVMHSDRGARSKMNTVNPEQLDH
LSKHWNLEAPVFSPRMHGNQMPAFITPVAQTPSYLSVPYLIHGPLSQAPLKPSATIPKSW
AQPAPPQLPARNSRLRLEGKVLVLLRGAPGSGKSTLARALLQNNPGGVVLSTDDYFNHNG
EYNFDPTVLGEAHEWNHKRAKEAFEKGNNPIIIDNTNMQGWEMKPYVAQALKHDYKVLFK
EPDTRWKHKPKELVRRTTHNVHVETIRRMLEGYERFVTVQSIMGSQMPERKQQVLLQNRI
SQPKLPDFHAHDKSPCPDLVGQPRLAEGCQTSSSQLFSSLPDVSSVGFSGDVGMPREGTP
KSTESLNLHLGEKPTDSPETSDENDDMNLGELDSELDAQLERNHPVLEQRMPDCIVESVM
NEDQCGDEIPVAFAESIGQRVRRERPSRRMEPADLVKDTNQVDSMTKVKEMIREEKVKRF
EVVRYEEEKVTPKTLNFVGDWPCEGPLMQREARKRERYNEVHGREDEDACQEASVYEKAI
RAQPAQPGPDLTEVQKLLDLIQTGVATVSTSSSHSPFLSLSSGEGSEREDEADGSSEDRG
DLPDCVLDWKAADSCIGQGSRIDDSDGFKIETEGPKDEERNTTEPETADLNSANKENPTS
ALDTDLLDSSKTLESNEGKLRQGRRSGKQCKLALTFTQNCPLSIDCPNTTAQNSDCCHSG
SAGETKPPTPPTLADTGCFTQTEPQDFALLWRLNRQTNPDDSADSVATGDIRVLYGDSSH
FVPELSSTVSAADAVHPSGHREVPYRVVHEKGTQLEEKELGLTQNRLESLRVLSRHFRLV
SFDTLEDLYDKCSQDIEWTTNLLLDSGERFFRDEDGEEEDGGAHIHDTSDLCAASCQAVE
SSLCPNMLDEDHPEDWPKEKPAVLEVETQQSTSVTVSESEESQNNIDVSDSAGAAVPVTN
HPDAIPDSEKAPETDLSVPESVKERERSDSAEPKVISESDQERGAWGGSSDNAIIEKSGA
EIEDEIANMEEMNRLLWAELEELEREEREEKQKREETRGRHHLDIQSVELKLPTELALQL
TELFGPVGVDPGSCSADDYAVQMDLNLAKLLHQKWKETIQESQRQAALSFHLLQESSVHW
GDSQAGKTGSRDQTQSGGPMPIMDHWNASRPLVSLREIMEEEQALQNNLEKTRKSRADLD
QRNGATLLKEKQLYALFPTIDRHFLQDIFRDHNYSLTEAELFLRSLLNEEPVKTVVAPEA
PRSDHHRPASKEREKKQRAVESAIPNYQDTEDPDYEDFRTEARLQRSRQLESFAKAAEAY
KQGRKEVASFYAQQGHLHGQRMREANHRAAVQIFERVNSSLLPSNILDLHGLHVNEALEH
LAQVLLDKTKECEQGLCRPQLSVITGRGNRSQGGVARIRPAVIDYLTNKHYRFTEPKPGL
VLVSLK
Download sequence
Identical sequences I3JR45
ENSONIP00000011339 ENSONIP00000011339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]