SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JTJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JTJ3
Domain Number 1 Region: 78-268
Classification Level Classification E-value
Superfamily Sec7 domain 4.06e-74
Family Sec7 domain 0.0000000524
Further Details:      
 
Domain Number 2 Region: 276-393
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-31
Family Pleckstrin-homology domain (PH domain) 0.00000801
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3JTJ3
Sequence length 411
Comment (tr|I3JTJ3|I3JTJ3_ORENI) Cytohesin 4a {ECO:0000313|Ensembl:ENSONIP00000012188} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100708606 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
IGALHNSCEGFKAFPEPDTRAHPNPTAPMKLPPEQRRQSEAHKFELLDDIQKLRLEINHV
MPEIHSPELKEQNKNVVRNRKFLRGKKKFNMDSKKGVQYLVENGLLEWRAESVAEFLYKE
EGLNKTAIGNFLGEREEMHLKILKAFVGLHEFSDLNLVQALRQFLWSFRLPGEAQKIDRM
MEAFAARYCGCNPGVFQSTDTCYILSFAIIMLNTSLHNPNVKDKPTLQRFVSMNRGINNG
EDLPTELLTKLYTSIRSEPFKIPEDDGNDLTLTFFNPDREGWLLKIGGRVKTWKRRWFIL
TDSCLYYFEYTTDKDPIGIIPLENLCVRALQDSSKPFCLELYNPKGQKIKACKTENKGRV
VQGKHQSYKLSAASAEERDDWIDAIRASITKDPFYDLVTLRKRKIISNTSS
Download sequence
Identical sequences I3JTJ3
ENSONIP00000012188 ENSONIP00000012188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]