SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JUW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I3JUW0
Domain Number - Region: 42-80
Classification Level Classification E-value
Superfamily UBA-like 0.0791
Family UBA domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3JUW0
Sequence length 338
Comment (tr|I3JUW0|I3JUW0_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000012655} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100691767 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MGTRVAVNQVLRLAVRNATISTLCPRQFGRYYLQSRWCCSSTNQATQHNQDLNPPSGIPV
TELSLRSFIDMGFTESQAEQIYESLANVRRGDSAKHILPTLTALFVLGLNPSSVKKCLEK
CPELYTIKEAQLQQRISNLRKMGLVEGSLQRVVAHYPRILTVPLKRVKNVVMFLKEKCLF
TSQQVTDIIRDCPAVVLENLDQLEYKFQYVYFRMGVKQAEMVKCRLFRYSLDEVRCRHTF
LERRGLYETPDKKGQTTIINPSLDSILNVDQDTFLAHVAQASAEEYDVFKRLAAREWQEE
ELQQGRTEPDSDDEDDDEDVDDDDDIEAKSGYGKRRKK
Download sequence
Identical sequences I3JUW0
XP_003438221.1.78416 ENSONIP00000012655 ENSONIP00000012655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]