SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JUW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JUW1
Domain Number 1 Region: 313-590
Classification Level Classification E-value
Superfamily Kelch motif 3.66e-72
Family Kelch motif 0.0000232
Further Details:      
 
Domain Number 2 Region: 46-161
Classification Level Classification E-value
Superfamily POZ domain 3.45e-34
Family BTB/POZ domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3JUW1
Sequence length 600
Comment (tr|I3JUW1|I3JUW1_ORENI) Kelch-like family member 24a {ECO:0000313|Ensembl:ENSONIP00000012656} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=klhl24 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MVLMLGRRLNREDSGIRDSPAVKRKVFEVESKNIASQDVLDFCSGSSHSEGILQVFNEFR
DCRLFTDVVISVQGREFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMESF
LNYVYTGRAKITTENVQFLFETASLFQITTLRDACAKFLEDQLDPCNCLGIQRFAEAHSL
KQLASRCQSYALANFSEVALHEEFLDLRKEELEEYINSDELSVCKEEFVFEAVMRWVYYS
VEARKPILKALLHHVRLPLLHPSYFVQTVEGDQLIQTAPECYHLLHEARRYHVLGNEMMS
PRTRPRRSTGYSEVIVVVGGCERVGGFNLPYNECYDPVTGEWKSLAKLPEFTKSEYAVCA
LRNDILVSGGRINSRDVWMYNSQLNLWIRVASLNKGRWRHKMGVLLGKVYAVGGYDGQSR
LSSVECYDSFSNRWTEVAPMKEAVSSPAVASCAGKLFVIGGGPDDETCSDKVQCYDPETD
SWLLRASIPIAKRCISAVSLNNLIYVCGGLTKSIYCYDPAEDYWMHVAQTFNKQESCGMS
VCNGKIYILGGRGENGEATDTVLCYDPATGIMTGASSMPRAISYHGCVTIHRYNDKYFKS
Download sequence
Identical sequences I3JUW1
ENSONIP00000012656 ENSONIP00000012656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]