SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JWE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JWE4
Domain Number 1 Region: 13-91
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.57e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3JWE4
Sequence length 605
Comment (tr|I3JWE4|I3JWE4_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000013189} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100694988 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MTTVSATPQQMRERLLQAIDSQSNICNMVVVLEVIACLEKYPITKEALEETRLGKLINDV
RKKTKDEDLAKRAKKLLRNWQKLIEPGPPVAASVPGSTNGSSHPCRTDASPSDISVPGKG
VPEVKIRNDVHNTYSPKAEKSSSRKRRAEHRDSGVYLQEKISKMSPYDNSVSTPPTNGIA
GSPDALPDQEVVPSPDRSRVEHLDNDKMNRIPVNAVKPRPSSPGVAKLPSTSSLIKVAVM
QQQARLDEGGGGYYQARSPRGLTTSPRSTKQDTMTKRSSAYAPKGTPVPSPSSRDSPLSF
SHTVSSPASSYADKLPHSSNRSSMHWASSSEASSLCPSQDISATLESPSVSPSPSLSQQN
SEPHRQMSEGAMVVSDDADGTTVPNSEHKRRKYRSRDYSVNLDGQKMEDTTKPVRLKERR
LTFDPVTGQIKPLVHKEPSQTDEAPTPDPPESRQRTESTVQQCTATTAVPGPSPNPFHHT
NWKELSRNEIIQSYLNLQSNVLNSSGVQAPSAHFFMSEYLKREEQEIKESRKMHVLQTDN
LTGDLPGVSRDVTDEDLDRIHTQHWQGVNGVFDTKGTWYDWTDCISLDPHGDESKLNILP
YVCLD
Download sequence
Identical sequences I3JWE4
ENSONIP00000013189 ENSONIP00000013189 XP_003437811.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]