SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JWG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JWG7
Domain Number 1 Region: 579-642,818-937
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.02e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0058
Further Details:      
 
Domain Number 2 Region: 913-1036
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.62e-26
Family Ypt/Rab-GAP domain of gyp1p 0.0095
Further Details:      
 
Domain Number 3 Region: 6-73,104-180
Classification Level Classification E-value
Superfamily RUN domain-like 7.45e-26
Family RUN domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3JWG7
Sequence length 1044
Comment (tr|I3JWG7|I3JWG7_ORENI) Small G protein signaling modulator 2 {ECO:0000313|Ensembl:ENSONIP00000013212} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=sgsm2 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MEEAVTKKFVHEDSSHIIALCTAIEACLGHLLKRRAAGFLRSDKIAALFTKVGKVCDTAG
EVCHKVQEQLQQQADLTRRTQSVGHEPLRRQGSSTTSRPPQPLSAQAIKHIWVRTALFEK
VLDKIVQYIVDNCSKYYEREALMHDSVFGPILAALLVGPCALEYTKLKTSDHFWTDPSAN
ELVQRHRIHGAHRGQDVLAGRRPALGIRKRQSSGSMSEDRFAASAREYVESLHQNSRTHL
LYGKNNVLVQPKKDMEVLRGYLSLHQAGDNLTLKWTPNQLINGTLGDCDLEKSIYWDYAL
TVPLRQIVCIHCHQRSDCGGTLVLVSQDGIQRPPLHFPPGGHLLAFLSCLETGLLPRGQL
EPPLWSQKGKGKVFPKLRKRSSAARLIDQEANGEEQSAADYVFRIVYPGYRYEAITINYH
HTTGSRAPSLDDDEEEEDRLHAMISMICSRNLTDPNVMKDHGDMMDTQGFGGSPSSWQQA
EVTTHESLCQSCSTAGSNVSFDYASGCTCIHDPSDIHTIPLKMLCQNMKRQIVSRAFYGW
LAYCRHLSTVRTHLSALVNHNIVPPDRPCEASGGLSKEVWSKYQKDCKNYKELELLRLVY
YGGVQHEIRKEVWPFLLGHYKFGMSKKDMSKIDAKISERYQQVMREWKACEVIVKQREKE
MQSAIFAKLSSGSSIDSHVLRLVHRDSTLSNEVFMSVDEQDAGSQETPSGEDSTPTMTNL
VPPVALPQEERPLVEFDSPDSGLPSSRNYSVTSAHSQILSSIDDGQSTEEEGGGAEDGRT
PSELAGCRDSLTEDRLCSQLDKLVTSGAAAEGTSPSLSSYTIELLDTVALNLHRIDKDVQ
RCDRNYYYFTTSNLEKLRNIMCSYVWEHLEMGYVQGMCDLLAPLMVILDDECLAYSCFTQ
LMKRMSQNFPNGGAMDSHFANMRSLIQILDSELFELMQQNGDYTHFYFCYRWFLLDFKRE
LLYDDVFAVWEVIWVAPRISSQHFVLFLALALVTVYREIIVDNNMDFTDIIKFFNEMAER
HDVQHILKIARELVHKVQSLMDNK
Download sequence
Identical sequences I3JWG7
ENSONIP00000013212 ENSONIP00000013212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]