SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JWP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JWP5
Domain Number 1 Region: 338-426
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 4.58e-33
Family Small-conductance potassium channel 0.00011
Further Details:      
 
Domain Number 2 Region: 205-377
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-25
Family Voltage-gated potassium channels 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3JWP5
Sequence length 480
Comment (tr|I3JWP5|I3JWP5_ORENI) Potassium intermediate/small conductance calcium-activated channel, subfamily N, member 4 {ECO:0000313|Ensembl:ENSONIP00000013290} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100704922 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MEMTNRSLHGDSKVDCVSCDGLISRNCGDSADVSVPLTLPGKRTTHMEGDDLYRLRDRKL
LLEDKKRLCAWALGTALFGILLMIIHAEICPYVYTPGSNIALIINCSISLSTGCLLILIT
AFHYKDIQLFIIDHNQVDWRIAMTSHRIIVITLELLVCVIHPVGSYWGVGLHVNSSSTVP
TPSPLCVSSHHGEALMDMELLLSVLMFLRLYLVHRAILLHSKVLLSASYRSIGSLNNINF
TFRFVLKVLMNKHPARMLLVFILFFWLTVSWMLTLCERQTKESTGHMDTALWLIAITFLT
VGYGDVAPKTNCGKAVCLFTGVMGVACTAMLVAIVTEKLALNKGEKHVHFFMMDIQISKR
IRHAAANVLRECWLLHRANVTKGNRGEHRKHQRCLLEAIRVFRHLRLKQRKLRDYVSEMV
DLPKMQMIMCDLSANWNNSYRELEQRILSMEQKLDELSRCFQQTSDLLSQAVRHRNPEIR
Download sequence
Identical sequences I3JWP5
ENSONIP00000013290 ENSONIP00000013290 XP_003458467.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]