SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3JZ66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3JZ66
Domain Number 1 Region: 778-832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000212
Family Laminin-type module 0.0009
Further Details:      
 
Domain Number 2 Region: 233-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Laminin-type module 0.04
Further Details:      
 
Domain Number 3 Region: 885-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000279
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 4 Region: 289-347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000725
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 5 Region: 398-444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000153
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 6 Region: 834-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.002
Further Details:      
 
Domain Number 7 Region: 680-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000753
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 8 Region: 723-780
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000046
Family Laminin-type module 0.0011
Further Details:      
 
Domain Number 9 Region: 345-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000865
Family Laminin-type module 0.0093
Further Details:      
 
Domain Number 10 Region: 933-978
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.022
Further Details:      
 
Weak hits

Sequence:  I3JZ66
Domain Number - Region: 638-677
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000201
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 41-123
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0085
Family CBM4/9 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3JZ66
Sequence length 1596
Comment (tr|I3JZ66|I3JZ66_ORENI) Laminin, gamma 3 {ECO:0000313|Ensembl:ENSONIP00000014161} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC102077756 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MPKFENIAFSRTVVASNVCGSPPEDYCMQTGSTRSCHICDASDPYLSHNTNLLTDFHRNE
EPTWWQSQSMYFRIQHPNSVNLTLHLGKSFEITYIRLKFYTSRPESFAIYKRTENDGPWL
PYQYYSASCRKTYGRDAKGYIRPGDNERTALCTDEFSDISPLTGGNVAFSTLEGRPSAYN
FDQSLVLQEWVTATDLLISLDRLNTFGDEFFKDAKVLRSYFYAISDFSVGGRCKCNGHAS
ECIEGEHGNLVCACQHHTVGADCQRCHPFYQDRPWARATGDSANECLKCNCSGRSDQCVF
DMEQYRSTGSGGRCVSCRDNTDGPHCERCRDGYYRKSTEDPCLPCNCNVNGSVSLQCDVE
GRCACRDGVTGGKCNTCQAGFHSIGPGGCRPCECDLSGSVGDCSPLDGRCYCKQNVEGQN
CNRCKPGFFNLQQVNPAGCQPCFCFGHSLACSSSNHHAAVNITSDFVEDQEGWLGEFSGG
LDYPLLWKEGEVYLLPLTEEDTGFYKAPVKFLGHKVYSYGQLLFITFASETPELLPGHIT
LVLEGSGITLSADLSSQPVLGYHPVLTPRHSFTIRLDENEKRFKPVLSAFDFQLLLYNLT
ALKISNAGGHNYTSQLAGVTMTSAVVSADPAFPPAPWVESCSCPPGFAGQFCEQCAPGFT
REEPARGPLSACIPCNCHQHGTCHPETGVCDCSDFTTGTTCERCLDGYYGNSLIGTPGDC
RPCPCPGQTSCVQIAETGQVVCTNCPAGQTGMRCQRCEDGYYGDPLGLSGAAQPCVRCNC
NGNVDFNAVGICDHVTGRCLKCLGHTEGDHCERCQQGFYGNALDQTAGQKCKPCSCSSAG
TSGHVNECHPQTGNCHCLSHVTGRDCSYCEVGFFNLQPGIGCEICKCNPIGSSSLACHPI
TGQCVCRTGVEGRLCDTCRLGFFGFSSRGCRACNCDPMGSVSMQCRSNGTCHCRQGFVGY
KCDKCELNYFHNRATHQCEECPVCYGLVKKQAEKLRTRLQDLEKLLAHFDCRGRFGKRHH
LLKYHMTRLYEHEHQREDTLPNALEDFLAFQEAREALIKQFSLLEASTGTLLAQLHGITS
SLNCSISMTEEEGKERRKDESSGAVCQTFTDTLHMIRVSQKQLKQATQDLDNMLIPFEAV
SRPNKWNIMVNDSQVLMKSHRETADHIEAIADRAVRASKQTYSSLMDLLQDNSTEEYIRN
LTEQIAQMQQQKENLTVQLNDTVVEQLALEEEAAGLKLALGNITSSLHQLALTDASPYPE
ADHTQFNQTKHLTNFTTEWGETLVKQTKELDQQVQTQDGLIAKVREVVEPLLQTVNNSME
RVNNISKLQTQAHGAKVVTLSSVVTGKEVESEAISLHRQLERMVTQWPRQQVQTKAAMKK
ARLLEEKILPDVRKKVAETEKMLKPALEHSNMSNSTAKDAKQKAQAVQKESKAILTQAKH
TRTTSAHLSSNIDSALEQLSVQELLTDRANAQITSEPGVSLASVKKDMEAAKLQLEAYSV
TLTELISKIDGNVPLERFDRILNETAHHLSMLRGSVESPTLGSKIQKLQSAAKEQQSRLS
LIEQDIQEITEERDSLRDIALNLPQSCPEATGAGKG
Download sequence
Identical sequences I3JZ66
ENSONIP00000014161 ENSONIP00000014161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]