SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3K0C8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3K0C8
Domain Number 1 Region: 558-749
Classification Level Classification E-value
Superfamily Sec7 domain 1.18e-62
Family Sec7 domain 0.00000734
Further Details:      
 
Domain Number 2 Region: 759-902
Classification Level Classification E-value
Superfamily PH domain-like 8.95e-17
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3K0C8
Sequence length 1110
Comment (tr|I3K0C8|I3K0C8_ORENI) IQ motif and Sec7 domain 3a {ECO:0000313|Ensembl:ENSONIP00000014573} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MVQEGKGGEGELQSEAQSQPQPQPELQPQPQQQQQETQPQTQPAQPQPQTEPQPQIQPQP
QPQPQPEVKPQPEPEPKAQPAPEPEPQPQVKAPSEAAPQEAPKAPSPCREEQTVAEKENQ
ESEEVVAAKTKQEVEEAQAKPREGEAAQEEEDEEGGGAKGGGAGRRASLHHTASPLRVQR
NGAGSHSAASDYELSLDLKNKQIEMLEHKYGGHLISRRAACKIQTAFRQYQLSKNFEKIR
NSLLESRLPRRISLRKVRVQNTEGFSAERALAEGCNLAGIPLVRSPSLPATVGGSLTDLE
DSFTEQVQSLAKSIDDALSNWSLKTMCSLQEGGNYQFSADSFSAAAAAAGVGGGGEGGGG
DVRDSAIHQGSVDPTDLSRSASKLMMAFRDVTVQIDSQNFRVSSSVRESSTSVTLNSGTQ
QEEASSTVTTTSTTEEELGEMEQPPLTPLDKMAFPQSPEEVVVVVPPPPREPTVAPPPQE
IVLGSSPAVEPLDVKRCGSETADNSSEQMSSSSTSTEARSTSEASSKEALQAMILSLPRY
HCENPASCKSPTLSTDVMRKRLYRIGLNLFNVNPDKGLQFLISRGFIPDTPIGVAHFLLQ
RKGLSRQMIGEFLGNSKKPFNRDVLDCVVDEMDFSGMELDEALRKFQAHIRVQGEAQKVE
RLIEAFSHSQRYCMCNPDVVQQFHNPDTIFILAFAIILLNTDMYSPNIKPDRKMLLEDFI
RNLRGVDDGADIPRDMVVGIYERIQQRELRSNEDHVTYVSKVEQSIVGMKTVLSVPHRRL
VCCSRLFEVTDVNKAQKQAAHQREVFLFNDLLVILKLCPKKKSSAAYTFCKAMGLLGMQF
HLFENEYYPHGITILSPFGSDKKQVLNFCAQSAEELLKFVEDLKESIAEVTEMEQIRIEW
ELEKQQGAKTHSVKNNGTQLELRGKQGSPSEKKKLLKGTKKSAGVNEVSIHNRLQTYQQG
PQGVTQGPAPPPQHLQLQSAASTPAHHLPLQQHHQPCVSMADLRPEALIQCQQIVKVIML
DNSSHGRMEAFLSQTPTHHHYQHHHHHSHHQLSHSAMSTPVRSPDGSHGSDGHQPPLPPP
PPPYNHPHQYIPPDPRLSLHRTPSGSRSMV
Download sequence
Identical sequences I3K0C8
ENSONIP00000014573 ENSONIP00000014573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]