SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3K1B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3K1B3
Domain Number 1 Region: 141-396
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-70
Family Nuclear receptor ligand-binding domain 0.00000762
Further Details:      
 
Domain Number 2 Region: 73-153
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-30
Family Nuclear receptor 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3K1B3
Sequence length 410
Comment (tr|I3K1B3|I3K1B3_ORENI) Nuclear receptor subfamily 2, group F, member 1a {ECO:0000313|Ensembl:ENSONIP00000014908} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=nr2f1 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MAMVVSVWRDPQEDVAGPPSGPNPAAQPAREQQQAASAAPHTPQTPSQPGPPSTPGTAGD
KGSQNSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYSCRANRNCPID
QHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISL
LLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSL
LRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKT
LHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLL
LRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQ
Download sequence
Identical sequences I3K1B3
ENSONIP00000014908 XP_003452669.1.78416 XP_004544446.1.88231 XP_005722415.1.53837 XP_005922893.1.24487 XP_006784158.1.46954 ENSONIP00000014908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]