SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3K1G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3K1G1
Domain Number 1 Region: 376-548
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-39
Family SPRY domain 0.0017
Further Details:      
 
Domain Number 2 Region: 9-80
Classification Level Classification E-value
Superfamily RING/U-box 1.39e-19
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 143-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000113
Family B-box zinc-binding domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3K1G1
Sequence length 559
Comment (tr|I3K1G1|I3K1G1_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000014956} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
IHTGQKMDQEKLCCSVCLDLLKKPVTLPCGHNYCMSCIKVHWDKEDPKGAYSCPQCRKVF
APRPELVKNTMLAELVEDLKTPGIQPASADLCYAGPEDISCDVCTGKKLKAVKSCLVCLV
SYCEQHLQPPHYDSSAFDSHKLVKPSNRLKGNICSTHNEVMKMFCHTDQKCICYVCCVNE
HNHHNTVQVEEERKHRQKDLKLILQKIQQRIQRRVEEAKVLDKEVEGIKVSADKAMKDSE
TIINQLVSYIKEKGTSLKQQIQLQQKEEESRVIELQKKLEQEITELKKMDEELKQLLHTE
DNTEFLLSYSLPFKLNDYTDSPSFKMCPVKYFEDFQTALLEIRDNLKAILAQEWRKITLT
VRSVDVLLPQSKPKTRDEFLKYSCQLTMDSDTVHPKIFLSNQNRSVSNTVQHPTNDFYFH
RRDRFSNQQQVLSKESLIGPCYWEVEMKGRGLSVAVTYKNKNNLDQSEFGSNNNSWALEC
YGDCYKFRHNKITTSLSGPLSSKVGVYVDPRAGILSFYSVSDTMALLHRVQTTFTEPLYA
GLWIWKSFWTDTTATFNEI
Download sequence
Identical sequences I3K1G1
ENSONIP00000014956 ENSONIP00000014956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]