SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3K1T1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3K1T1
Domain Number 1 Region: 373-542
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-47
Family SPRY domain 0.0014
Further Details:      
 
Domain Number 2 Region: 9-81
Classification Level Classification E-value
Superfamily RING/U-box 2.87e-21
Family RING finger domain, C3HC4 0.0082
Further Details:      
 
Domain Number 3 Region: 143-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000153
Family B-box zinc-binding domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3K1T1
Sequence length 549
Comment (tr|I3K1T1|I3K1T1_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000015076} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MAERGLQLDQERFSCSICLDLLNEPVTTSCGHSFCKSCIRSHWDAEDQKGTYTCPQCRQA
FVSRPVLGKNTMLADLVEELKKNVLQAAPNPQHYAKPGDVACDVCTERKLKASKCCLQCM
ASYCELHLQPHYESPNFQRHKLVEALAKLQENLCSVHSKVKEIFCCSDQQCICSVCAMEE
HSGHDTVSAIAERAERQRELGPRRLDIQQRIQDKEKHTKLLQQQMEAIDSSADKAMRDTQ
TMFNQLHRLVEKRSSDVQQQIRFQQQTELSWAKELQKKLQQELTDLRRRDAELEQLSRTE
DHGQFLLSYALLSGLSESTHSASINIHPQSYFQEVTAAVSELINKLQCILSQDWSEVLLT
ERETLSPVEPTTRAEFLQYSKRITMDQNTAHRELLLSEGHRRVTFGYTILSYSDNPERFR
ECSQVLSREILTGCCYWEVKWKRFVSIAVAYNCINRTGNDSEFGYNDKSWSLECDCNSYK
FRHNNIITFLSVPQCSRVGVYLDHSGGILCFYSVSETMTLIHRVQTTFTQPLHAGLWVDI
SGSAEFVEL
Download sequence
Identical sequences I3K1T1
ENSONIP00000015076 ENSONIP00000015076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]