SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3K3D8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3K3D8
Domain Number 1 Region: 55-310
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.96e-98
Family Protein kinases, catalytic subunit 0.00000988
Further Details:      
 
Domain Number 2 Region: 697-806
Classification Level Classification E-value
Superfamily KA1-like 2.13e-44
Family Kinase associated domain 1, KA1 0.00000613
Further Details:      
 
Weak hits

Sequence:  I3K3D8
Domain Number - Region: 308-367
Classification Level Classification E-value
Superfamily UBA-like 0.0373
Family UBA domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3K3D8
Sequence length 806
Comment (tr|I3K3D8|I3K3D8_ORENI) Non-specific serine/threonine protein kinase {ECO:0000256|SAAS:SAAS00804148} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=mark3 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MSTKTPLPTVNEKVTESVSRRHTSHTNGRQEISTRPGRTGVRPARSSEEPQQPHVGNYRL
LKTIGKGNFAKVKLARHMLTGREVAIKIIDKTQLNPNSLQKLFREVRIMKILNHPNIVKL
FEVIETERTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRD
LKAENLLLDADMNIKIADFGFSNEFTLGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWS
LGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPAKRGTL
EQIMKDRWINAGFDDDELKPYTEPELDITDQKRIDVMVGMGYNLEEIQDSLAKMKYDEIT
ATYLLLGRKASELEPGDSASSSNLSLAKPRPSSELNGQSPSHLKVQRSVSSNHKQRRYSE
QVGQNLPPGMAHPKRSQTTTAENSVKEEGGVQLRKPSIPGTRGAPPSSPLMGNANNPNKA
DIPDRRKGATTAPSNNTASAGMTRRNTYVCSDRNNTDRLSVIPNGKENRFRQAGPRCPTP
TTLWTTARPKSQLLRLCIIWLHHTLPAQMSGNVHNVAVSPGSQRNPVASTHSVANATTPD
RLRFPRGTASRSTFHGGQLRDRRTATYNGPPASPTLSHDATPLSQTRSRGTSNLFSKLTS
KLTRRNMSFRFTKSNPNESSGKPKRQFTRLSSRHVPGDQKGENKDGKPRSLRFTWSMRTT
SSMEPCDIMREIRKVLDANNCDYEQQESFLLLCVHGDGRAENLVQWEMEVCKLPRLSLNG
VRFKRISGSSIAFKNIASKVANELKL
Download sequence
Identical sequences I3K3D8
ENSONIP00000015633 ENSONIP00000015633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]