SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3K3P8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3K3P8
Domain Number 1 Region: 339-524
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-69
Family SPRY domain 0.00000224
Further Details:      
 
Domain Number 2 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 2.7e-20
Family RING finger domain, C3HC4 0.0078
Further Details:      
 
Domain Number 3 Region: 143-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.29e-17
Family B-box zinc-binding domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3K3P8
Sequence length 528
Comment (tr|I3K3P8|I3K3P8_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000015743} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100702478 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MSAASSLRSEDQFLCSICLDVFTDPVSTPCGHNFCKNCITQYWDTNQRCQCPMCNETFNT
RPHLRVNTFISEMVAQFKCEVQQKASSSSSEQQAAKPGEVPCDICTGTRLKALKSCLVCQ
ESYCQTHLEPHLTKKGLKKHQLIEAVEKLEGRMCKKHDKPLELFCKSDQTCVCMLCSVSD
HKNHKFIPLREEYEGKKAELEKTEAEIQQMIQKRRLKIQXQVFTALKESVDRGLKELIKE
IEDKQETTEKQAEGLIKDLKQEISELKKRSSEVEQLSHSEGLVHFLQSFSSLKAAPPTKN
WTEVSIHPPSYEGTVVRAVAQLEETLRKLRKKKLSEAELKRVQQYAVDVTLDPDTASPVL
ILSDDGKQVHCGDVKKNLPDNPERFSYCVNVLGKQSFSSGRFYFEVQVKGKTKWDLGVAR
ESINRKGKITATPQNGFWTVALRNGNEYKALTDPSVPLCLQSGPEKVGVFVDYEEGLVSF
YDVGAAALIYSFTGCSFTHKLHPFFCPCLSDGGNNSAPLIICPVNQTE
Download sequence
Identical sequences I3K3P8
ENSONIP00000015743 ENSONIP00000015743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]