SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3K481 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3K481
Domain Number 1 Region: 14-87
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 4.32e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3K481
Sequence length 574
Comment (tr|I3K481|I3K481_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000015926} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=med26 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MTAATATPQVMRDRLLQAIDGQSNICNMVVVVEVISFLEKYPITKEALEETRLGKLINDV
RKKTKNEDLAKRAKKLLRNWQKLIEPGKVEVLSKGGTGTSWSSIGGAHPCISAPAANPPS
GKTGPELKNRNDFNNCSLRVEKLSNRKRKGEQKEGPILPAKIPKMTLNDKIQNSKQLQTN
GIGAGAEIFADIRAHQSLDRDIPEALDNDKLNKIPVHAVKPHSNFPGCSKPPSTSSLLKA
SVLQQQARQEPAASGGKCRPRSPRCSLHSPQTLKQEAVVKQTAPQAQSIPGPSVRPGTVD
NSGLGLPPQAFSASVQGFHTDGSGSADLDSHRLPPSMSLHGSTATPCSGVESLEDEGPSF
NTGKRKRQKYRPKDYSVNLEGQTVEDRTKPVRLKDRRLTFDPVTGQIKTSFQKDSFPEGE
VRPNNKPENNWSEQPKQNPPVPPSPFQQTDWKELSRSEIIQSYLSQQSNVLTSSGAHTPG
AHFFMSEFLKKEEHQSKDAKKTHTLVSDSPPREIPGVSREVNGKDLSRLHTQHWSGVNGC
YDTMGKWYDWTECISLDPHGDESRLNILPYVCLD
Download sequence
Identical sequences I3K481
ENSONIP00000015926 XP_003449116.1.78416 ENSONIP00000015926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]