SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3K4Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3K4Y1
Domain Number 1 Region: 518-762
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-60
Family Nuclear receptor ligand-binding domain 0.0000000135
Further Details:      
 
Domain Number 2 Region: 404-482
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-25
Family Nuclear receptor 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3K4Y1
Sequence length 763
Comment (tr|I3K4Y1|I3K4Y1_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000016176} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MSQTTRELFCAKIWPEDRKSYTGDVVSAASMAQKTEESRVYFTKTPAGSSAASLAESENA
NLYGHIIPLACDMEKRCCQTAAAPQEELSAECRVGDSRSFSACATISETARELCKAVSVS
LGLAMESGDTSETHVSLPQCAANDQMSAEYLFGVEAVPANCPGAPASLSEYRCPERDERP
PHDHKQQVKMLKSSEPAAAFHHLSSTATSVNAQNFTLCEADDITPKEIDHLDIACAASCP
YAPAAPEPLAQFGPAAAQRPCRAYNPVEEAGDVGDAGENRSVGFQAERYGVKVKSEGSAS
AGALWVSRPNYSFGDKYNSQFWGSRQCMNLQSSGANSAFICNPYDGTVMRREQWYPGGML
RTPYPNSNYMKGEVGEWLDVTYNDTRFESSREHMFPMEFFFPPQRTCLICSDEASGCHYG
ALTCGSCKVFFKRAAEGKQKYLCASKNDCTIDKLRRKNCPSCRLKKCFEAGMTLGARKLK
KIGQQKSPEEDHGAQDPVEVIPNVSPKTGVQLNSHLVFLNILESIEPEVVNAGHDCGQPD
SADTLLTSLNELGERQLVKVVKWAKGLPGFRNLHVDDQMTIIQQSWMGVMVFALGWRSYK
NASGRILYFAPDLVFNEHRMHVSTMYEHCIRMRHLSQEFEMLQITQEEFHCMKALLLFSI
IPVEGLKSQKYFDELRLTYINELDRLINFQTTTNTSQRFYQLTRLMDSLQMTVKKLHQFT
FDLFVQAQSLHTKVSFPEMIGEIISVHVPKILTGLAKPILFHK
Download sequence
Identical sequences I3K4Y1
ENSONIP00000016176 ENSONIP00000016176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]