SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3K5G9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3K5G9
Domain Number 1 Region: 320-490,526-661,721-827
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.75e-82
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0009
Further Details:      
 
Domain Number 2 Region: 174-282
Classification Level Classification E-value
Superfamily RING/U-box 2.24e-36
Family Zf-UBP 0.00000349
Further Details:      
 
Domain Number 3 Region: 685-739
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000488
Family UBA domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3K5G9
Sequence length 829
Comment (tr|I3K5G9|I3K5G9_ORENI) Ubiquitinyl hydrolase 1 {ECO:0000256|SAAS:SAAS00003083} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=usp5 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MADVGELLMSVLSTIRVPKPGDRVHKDECALSFSSPESEGGLYVCMNSFLGLGSQYVDRH
HARSGQRAYLHITRTRKAKKEDDGNSGSGHPPKKKPTRLAIGIEGGFDVEQEQYEEDVKV
VILPDRQEVTSEDLTTMPDVVRERVSLSMAGIMAADSVSHTLQVQQWDGEVRQESKHAAD
LKQLDNGVKIPPSGWRCEVCDLQENIWMNLTDGKVLCGRRYFDGSGGNNHALLHYQETGY
PLAVKLGTITPDGADVYSYDEDDMVLDSKLPEHLAHFGIDMMTMEKTERTMTELEIAVNQ
RVGEWEVIQESGTTLRPLFGPGLTGMKNLGNSCYLNSVMQVLFTIPDFQSKYVSNIDKII
DEAPSDPTQDFKTQVAKLGYGLLSGDYSKPAPDPGEENGAAEPRGDQIGIAPQMFKALVG
RGHPEFSTNRQQDAQEFLLHFINMVERNCRSGSNPSEAFRFLVEERIVCQQSQKAKYTQR
VDYIVQLPVPMDQATNTEELQEAERRREEGDSSAPTVRAQIPFTACMAALSEPEILTDFW
SSAVQGKTTATKTTRFASFPDHLVIQIKKFTFGLDWVPKKLDVSIDVPDTLDLSGLRATG
QQPGEELLPEVAPPPLMTPDVEVKAPVLDDSTVSQLCEMGFPLEACRKAVYYTGNTGIDA
AMNWIMSHMDDPDFSAPLVLPGCSSGPGTTPTESLSEEHLATIVSMGFSRDQATKALRAT
SNVLDRAVDWIFSHLDDLESMDVSEGGRSAAESEGGRDPPPGPRVRDGPGKYELFAFISH
MGTSTMCGHYVAHIKKDQQWVIFNDQKVCASEKPPKDLGYLYFYRRVAE
Download sequence
Identical sequences I3K5G9
ENSONIP00000016364 ENSONIP00000016364 XP_005455534.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]