SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3K7E0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3K7E0
Domain Number 1 Region: 46-301
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-97
Family Protein kinases, catalytic subunit 0.0000099
Further Details:      
 
Domain Number 2 Region: 686-790
Classification Level Classification E-value
Superfamily KA1-like 8.5e-44
Family Kinase associated domain 1, KA1 0.0000158
Further Details:      
 
Weak hits

Sequence:  I3K7E0
Domain Number - Region: 315-360
Classification Level Classification E-value
Superfamily UBA-like 0.0553
Family UBA domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3K7E0
Sequence length 790
Comment (tr|I3K7E0|I3K7E0_ORENI) Non-specific serine/threonine protein kinase {ECO:0000256|SAAS:SAAS00804148} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=mark2 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MSTRPPLVQVIENSTGQESKLSSGRSSTSRGRNSVATTTSDEQPHIGNYRLLKTIGKGNF
AKVKLARHVLTGKEVAVKIIDKTQLNSSSLQKLFREVRIMKMLNHPNIVKLFEVIETEKT
LYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKCIVHRDLKAENLLLD
ADMNIKIADFGFSNEFTLGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLV
SGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGSLEQIMRDRWM
NVGYEEEELKPYIEPQPDYKDPRRTDIMLQMGFSQEEIQDSLVNQKYNDVMATYLLLDYR
NSELDEGGIKPRPGSDVQRSVSSNQKPQNRRTGDQGSSYSKRGGQTDNRSAGEDSGRKGS
SGSSTTKVPASPLASSDRKKSATPSTNSILSTGTGRSRNSPLTDRATLDQSIQNGKDSLN
TPGSRASTASAAAVLSSSSSSSSRPRHHKSLSSSNHPCPSDLHAPRPSAPAQRAPGASPS
AHNISSAAVSDRTNFSRGVGIRSTFHAGQQRSARDQQGSAYPGGPASPSLSHGNSQARRT
HGATGIFSKFTSKFVRKNLSFRFPRRGPYEGEGLDEGSRSVLTSTVDKSEKTSGGLSSSS
NNDENNSSPGSGNTGGTGTPPAISSQKDPVKPRSLRFTWSMKTTSSMEPTEMMREIRKVL
DSNSCEYELRERYMLLCMSGKPAHDDFVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNI
ASKIANELKL
Download sequence
Identical sequences I3K7E0
ENSONIP00000017035 ENSONIP00000017035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]