SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3K7M2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3K7M2
Domain Number 1 Region: 105-154
Classification Level Classification E-value
Superfamily UBA-like 0.0000373
Family UBA domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3K7M2
Sequence length 165
Comment (tr|I3K7M2|I3K7M2_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000017117} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
EDTLNSCPPSQPPPPPPPARHSFTEPPSSSSSYMPPSGHEHVLLTPDSVFGMVNSAAPPH
PAKRQTDNVKDSRGILEYNHPVSLDCLQAPARPPKPYPRKIPPEIQPEKPHSLVLESEDA
KIAKLMGEGFAFDDVKRALMIAQYKVDVARNILREFALVAPRLNL
Download sequence
Identical sequences I3K7M2
ENSONIP00000017117 ENSONIP00000017117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]