SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3K9Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3K9Q2
Domain Number 1 Region: 21-70
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 7.32e-19
Family Cysteine-rich DNA binding domain, (DM domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 229-279
Classification Level Classification E-value
Superfamily UBA-like 0.000000158
Family UBA domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3K9Q2
Sequence length 470
Comment (tr|I3K9Q2|I3K9Q2_ORENI) Doublesex and mab-3 related transcription factor 3a {ECO:0000313|Ensembl:ENSONIP00000017847} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=dmrt3 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MNGYGSPYLYMGTPVSQPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILI
IERQRVMAAQVALRRQQANESLESLIPESLRVLPGIGLAGTGEGNQPAPPRTEELELRWS
STEPGQPGAPLCSEPTEDGADEVSAGENGESSSEKEQDAVSSPEASKPNCYTPEPPGTPS
LPEESRYGLPKAGSAEKEAKAESPQKYPASPAEQGVLIEGLGGSITLPLSLRANRPPLEV
LKKIFPAHKPPVLELILRGCGGDLVGAIEVLLSSRNPDASAPPHADVHADALVLPSNGHL
FEPGLGSYHPASSSAKWSVGSAFRVPDSLRFTSDSAAGVVSTGALGVPLQHPSFPQPTRY
PLMLRSSLTRSHAGPFVHNDVTLWNSVALQQQYQLRSAAQYVSPFPPGAPGGPGLFRGSP
LLPSRPSEEPRVGIQEEGCPLGPKPGLYSPDEEYEERSDSADSRILNSSS
Download sequence
Identical sequences I3K9Q2
ENSONIP00000017847 ENSONIP00000017847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]