SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3K9S2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3K9S2
Domain Number 1 Region: 686-881
Classification Level Classification E-value
Superfamily Sec7 domain 4.97e-76
Family Sec7 domain 0.00000188
Further Details:      
 
Domain Number 2 Region: 443-626,1135-1150,1181-1529
Classification Level Classification E-value
Superfamily ARM repeat 1.54e-28
Family PHAT domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3K9S2
Sequence length 1852
Comment (tr|I3K9S2|I3K9S2_ORENI) ADP-ribosylation factor guanine nucleotide-exchange factor 1 (brefeldin A-inhibited) {ECO:0000313|Ensembl:ENSONIP00000017867} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=arfgef1 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MFEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKEESEKLSPPGGDGKS
GSSTLPPIKSKTNFIEADKYFLPFELACQSKCPRIVITSLDCLQKLIAYGHLTGSAPDST
APGKKLIDRIIETICACFQGPQTDEGVQLQIIKALLTAVTSQHIEIHEGTVLQAVRTCYN
IYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQLERERHRQHSPVTQHTEPDSA
QHQTHIHSPAKGPTREANGPLTPPTPSITEEKGENPDPENGSEFCVAESEQTEADQATAA
AESAAAQKHAEAAEDEDRETPNYEEKAQEIVQSILQEVVNTVAGAATEGTQSSLEDEGTV
GSDSEHVHANGIPGTPISASFTPSLPDDRLSVSSNDTQESGAAPGQPPGAKFSHILQKDA
FLVFRSLCKLSMKPLSDGPPDPKSHELRSKVLSLQLLLSILQNAGPIFKTNEMFINAIKQ
YLCVALSKNGVSSVPEVFELSLSIFLTLLSHFKTHLKMQIEVFFKEIFLYILETSTSSYD
HKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRGGHELGITPQ
QELTLRKKGLECLVSILKCMVEWSKDQYVNPNSQTSLGQEKPSEQESTESKAPETINRYG
SINSLDSTASSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQGIDLFNKKPKRGIQYLQEQ
GMLGTTPEDLAQFLHQEERLDSTQVGEFLGDNDRFNKEVMYAYVDQMDFQGKDFVSALRM
FLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQV
KNKMTKEQYIKMNRGINDSKDLPEEYLSAIYDEIAGKKIAMKETKELTMKSNKQSVASEK
QRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFSVGLQ
DCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLTATSGIAEMKQKNIDT
IKTLITVAHTDGNYLGNSWLEILKCISQLELAQLIGTGVKARYISGTVRGKEGFIASTKE
QSSDEYLGLVGGTVDRKQIASIQESIGETSSQSVVVAVDRIFTGSTRLDGNAIVDFVRWL
CAVSMDELASPTHPRMFSLQKIVEISYYNMGRIRLQWSRIWEVIGDHFNKVGCNPNEDVA
IFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIRDMVVRCIAQMVNSQ
AANIRSGWKNIFSVFHLAASDQDESIVELAFQTTGHIVTNVFEKHFAATIDSFQDAVKCL
SEFACNASFPDTSMEAIRLIRHCAKYVSDRPQAFKDYTSDDMNVAPEDRVWVRGWFPILF
ELSCIINRCKLDVRTRGLTVMFEVMKTYGHTFEKHWWQDLFRIVFRIFDNMKLPEQQTEK
AEWMTTTCNHALYAICDVFTQYFESLNGVLLDDILAQLYWCVQQDNEQLARSGTNCLENV
VILNGEKFSPETWDKTCNCMLDIFKTTIPHALLTWRPAGAEGEHLSTQSLPDKQLDSVSQ
KSLDIQSRSDDQHSISSSDRAAMENRRQSQYSSASGVTEDGPRSRTQTKIQEQRLFSALL
IKCVVQLELIQTIDNIVFFPATSKKEDAENFAAAQRDAVCSADVSVETQDQGMYRYLTSE
QLFKLLDCLLDSHHFAKAFNSNNEQRTLLWKAGFKGKSKPNLLKQETSSLACGLRILFRM
YTDESRRDAWEEVQRRLLNVCSEAVAYFLALTSESHREAWTNLLLLFLTKVLKISDERFK
AHASRYYPLLCEIMQFDLIPELRAILRKFYLRIGIVFNIAQLPEPEPQQARE
Download sequence
Identical sequences I3K9S2
ENSONIP00000017867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]