SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KA25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KA25
Domain Number 1 Region: 50-91
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000575
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 2 Region: 11-53
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000405
Family Somatomedin B domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3KA25
Sequence length 240
Comment (tr|I3KA25|I3KA25_ORENI) Somatomedin B and thrombospondin type 1 domain containing {ECO:0000313|Ensembl:ENSONIP00000017970} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=SBSPON OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
SGKCCRGRDTNCLTTDWRMDRVHGTCYCDEGCVRTKDCCFDYFTECPAQDCVVSDWSFWS
GCAKPCQPSVRIRVRHIEQQPHNSGQPCPGLEQRAGCREYRDHQGRHCGFNSGPAFITSM
AFAKGRPKHDRKSAYTKGWDDSRFCVEFKLESRTPHCTVENRPHTLWMRYITEGFNVCVA
CEPPAMRNNTSSCQGDGQESDKETVLHWQAVGNPRCSGTWKKIQKTQQCACPPQHSFVFI
Download sequence
Identical sequences I3KA25
ENSONIP00000017970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]