SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KC16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KC16
Domain Number 1 Region: 37-92
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000472
Family CUE domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3KC16
Sequence length 383
Comment (tr|I3KC16|I3KC16_ORENI) CUE domain containing 1b {ECO:0000313|Ensembl:ENSONIP00000018661} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=cuedc1 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MTSLFKRSSSNGGSRSSGNGGGGGSGQGQLNNSRPSRQVRRLEFNQAMEDFKTMFPSMDY
EVIECVLRSNNGAVDATIDQLLQMSIDGQGSDDSSDSDDSIPPEILERTLEPDSSDEEAP
PVYSPPTYDMHIYDRKYLEAPPTPSPRSKPQPPSAHQQVRSYRNWNPPLLGNLPDDFLRI
LPQQLDNIKSSQNSLSQLSSSSSSVSSLSQWTVQSGSGYAAGTTGGPGLITAATEQDKKL
KQYLEDERVALFLQNEEFMRELQRNHEFLIALEKDRLKYESKKSKSNHSTSLENSTGDQY
SGASMEAISDDMFRDKLKHMGKSTRKKLFEIARTFSEKTKRRKSKRRTLLKHHSLGTANS
TANLLDDVEGHHCGKKSCEPYNA
Download sequence
Identical sequences I3KC16
ENSONIP00000018661 ENSONIP00000018661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]