SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KDN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KDN4
Domain Number 1 Region: 155-435
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-71
Family Nuclear receptor ligand-binding domain 0.00000000895
Further Details:      
 
Domain Number 2 Region: 103-187
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-30
Family Nuclear receptor 0.0000084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3KDN4
Sequence length 437
Comment (tr|I3KDN4|I3KDN4_ORENI) Estrogen-related receptor beta {ECO:0000313|Ensembl:ENSONIP00000019229} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100690064 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MPSEDRHLSSSCGSYVKTEPSSPSSSLIDTGSHHSPSGNSDASGGYVNVGSGRSHTLDSP
PMFNPGMLGGGSACLRRYEECSGGMADDSPIKCEYMLNGIPKRLCLVCGDTASGYHYGVA
SCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRV
RGGRQKYKRRLDAENGAYLGLTLPPPAKKPLTKIVSHLLVVEPEKIYAMPDPTMPDGDIK
ALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILVLSIVFRSLPCEDE
IMYAEDYVVDEEQARISGLLDLHVAILPLVRRYKKLRMEKEEFVTLKAIALSNSDPDSMH
IENIEAVQRLQDSLHEALQDFEGSQHPEDPRRAGKLLMTLPLLRQTATKAVQHFYSIKMQ
GKVPMHKLFLEMLEAKA
Download sequence
Identical sequences I3KDN4
ENSONIP00000019229 ENSONIP00000019229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]