SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KEB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KEB0
Domain Number 1 Region: 16-362
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.02e-120
Family Motor proteins 0.0000000000278
Further Details:      
 
Weak hits

Sequence:  I3KEB0
Domain Number - Region: 699-822
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0863
Family HBL-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3KEB0
Sequence length 1063
Comment (tr|I3KEB0|I3KEB0_ORENI) Kinesin family member 11 {ECO:0000313|Ensembl:ENSONIP00000019455} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=kif11 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MSSNVQSGGKREEKGRNIQVVVRCRPFNTMERKSSYGVIDCDQNRKEVMVRTGGMNDKAS
RKTYTFDMVFGPSAKQIEVYRSVVCPILDEVIMGYNCTVFAYGQTGTGKTFTMEGERSPD
EQFTWEEDPLAGIIPRTLHQIFEKLSENGTEFSVKVSLLEIYNEELFDLLSPTEDVSERL
QLFDDPRNKRGVVVKGLEEVTVHNKDEVYQILERGAAKRRTASTLMNAYSSRSHSVFSVT
IHMKEITLEGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVITAL
VEKRPHVPYRESKLTRILQDSLGGRTKTSIIATVSPSSSNLEETLSTLEYASRAKNIMNK
PEVNQKLTKRTLIKEYTEEIERLKRDLAATRDKHGVYLSSENYESMVAQITAHEEQITEY
NDKIAIMEEELKKVTELFVDSKARLEQCTADLDEKQQRLEETSRDLQETKVKLSEEEFIC
SELSSVQETLYDTAGQLLSTADASTSDVSGLHDKLDRKKKVEEHNREIQQSFAQQMEGSF
RDVQRCIQQHGDKQRHMLSSYSQAVDGLLMMNEAALKGALTTVESFVGGVRPLVAESVAR
CEEKVQQNEMLCLQDKESVLQLLEEHRRDMEEVLVVQTLMGLSAAKELNDSLRASVEKQR
ALADKAEAMKEMGVVFDSLVRELAALREATVQSLSALQAERNELEDKIRQAEEEIEQKDM
KETIQCLQDQLNLLTVKVKKKFTGLYSASRGLQKPLQSLQEDISRGCSTVEHQVSAQADL
LSSSASSLISSLRLTADESQQSLEEMSGCCSHIHSSVTGLLERDLEWSSRVKEHAEKRAE
EQLTLMRKVGSEAQDLRQSVEDRCSEQLRAAKVEISNHQQEVTRALTAVKDQTSIDWSAL
HEQRAELLQHVEASEQLVHSFLRDELQEDVPTGATPQRREFVYPRQLVKSRRRSELLESL
RRQQEELQAAMEAEEEEELEDEDKQSQTDPDSLEDDLSTCNESLATEPSFIDENLVFNES
KRVPFFKKKKGKKETKIPSRSKVSENEAESTPQRSRLPLRCQN
Download sequence
Identical sequences I3KEB0
ENSONIP00000019455 ENSONIP00000019455 XP_003455739.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]