SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KFY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KFY0
Domain Number 1 Region: 212-465
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.54e-87
Family Eukaryotic proteases 0.00016
Further Details:      
 
Domain Number 2 Region: 123-225
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000719
Family Scavenger receptor cysteine-rich (SRCR) domain 0.056
Further Details:      
 
Domain Number 3 Region: 87-126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000903
Family LDL receptor-like module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3KFY0
Sequence length 466
Comment (tr|I3KFY0|I3KFY0_ORENI) Transmembrane protease, serine 2 {ECO:0000313|Ensembl:ENSONIP00000020025} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100711940 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MNNNQANGPMYDNQVFKHEEYSPPYSVTEQIPSHSSINQYYTSTPGIPANPRQTKGRKKC
HWKYILGALLCVTVILAVLGLLLWYFLYYRCLLGKSCGKGGMCLSHTRWCDGIIDCPDEE
DESQCFRLQGANSMLESYSSSSQTWMPVCADNWDNNYGRTVCRQIGYSRDDYFAYSQTSA
GVLASNGYMRLKSGSSSGSLIQSQLTHSLLCFSNAVTLQCIECGKSSAAPSSRIVGGTEA
VNGAWPWQVSLRVSGRHSCGGSIISPYWILSAAHCFEYYSSPSSWMVYYGDVNLNKMFNG
GGVQKIINHKDFDTRTNDYDIALLKLYTPLTFNNKVRPVCLPNVDLNLSGNRQAWITGWG
ALQSTGPSPNIMNQAQVTIYSRATCNAPEVLNGEVTKTMFCAGKLQGGVDSCQGDSGGPL
VVKEGDRWWLAGATSWGYGCALKNKPGVYANVPFFIDWIFKKIQNN
Download sequence
Identical sequences I3KFY0
ENSONIP00000020025 ENSONIP00000020025 XP_005454655.1.78416 XP_005454656.1.78416 XP_005454657.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]