SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KG32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KG32
Domain Number 1 Region: 61-151
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000000000000301
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.01
Further Details:      
 
Domain Number 2 Region: 800-825
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000641
Family CCCH zinc finger 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3KG32
Sequence length 833
Comment (tr|I3KG32|I3KG32_ORENI) Protein phosphatase 1, regulatory subunit 10 {ECO:0000313|Ensembl:ENSONIP00000020077} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MAGGPVDPREILKGVETLLGKDGELRSLEGVPKVFSLMKASTKMVSRCMYLNILLQTKSH
DVLNRFIRVGGYKLLNAWLTYSKTTNNSPLLQLILLTLQKLPLKVDHLKQNNTAKLVKQL
SKSAETEELRKLAAVLVDGWMATIRSQSVSGSTTSPAVLDKKKKKEETKVPVRDMKEKGG
DEEKKDKPKAHAPSHTKIRSIGLEIGDPPNPAPPKKTPTAPQLGSKYNIKPPVLKRHSYS
SGSGDAPPQEKKYKPLNTPSNSAKEIKVKIIPAQPMECTGFLDALNSAPVPGIKIKKKKP
SANTTASTKVVSPTTNKASPFESKPVYSASSTKPASPESAASTTPADENQEPEQPGTPVP
SEDPEPSDNGEKPNALAEPRGEEESLTKKGKKKKTVHWAEEEQLKHYFYFDLDETERVNV
NKIKDFGEAAKRELMMDRQTFEMARRLSHDTMEERVPWTPPRPLTLAGSLVTPGANSTEK
LTQRDREMGILQEIFLSKESPHEPDPEPYEPMPPRLIPLDEDSSMMDEGYVEPMDTTSQP
GSGESAKLPPVLANLIGNLNNSSRSPQASNTVSNTVPPSVNIQELLSSIMGPSGNQSTEE
LIKQPDFSDKIKQLLAVNQGLLGHGPGMNSMNTMHMQMPMNGGYPPNNSPGGPRFNHPPP
PHNHGPPFSGGGGPRMMGPPPGQGRGDGNYWGDDSMRGGPHRGGHFHRGGRGRGGGDPGF
RGRGRGGPRGGGHNNMNGTLFSSLILMCLYSAQSLQTVQKYLEYVSLQCGNLEYKKSHII
VTNLLLSPSLFHIRHPADMSKRPVCRHFMMKGSCRYEGSCAFYHPGVNGPPLP
Download sequence
Identical sequences I3KG32
ENSONIP00000020077 ENSONIP00000020077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]