SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KGR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KGR1
Domain Number 1 Region: 150-372,416-466
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.57e-51
Family LacY-like proton/sugar symporter 0.054
Further Details:      
 
Domain Number 2 Region: 582-721
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.35e-18
Family Glycerol-3-phosphate transporter 0.027
Further Details:      
 
Domain Number 3 Region: 489-559
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000419
Family Pentapeptide repeats 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3KGR1
Sequence length 733
Comment (tr|I3KGR1|I3KGR1_ORENI) Synaptic vesicle glycoprotein 2C {ECO:0000313|Ensembl:ENSONIP00000020306} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=sv2c OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MEDTYNNRTSLVKGAKDIVKEAKKHATKKVNKVVDHATDEYSSHRNYTRFQDEVDEDEDF
YQNPPRQDGESYRDNEEGSSDATEGHDDEDEIYEGEYQGIPSSAGDKKQGQVALGKPMSD
ATKDRGELEQERQADEEELAQQYELIIQECGHGRFQWQLFLVLGLALMSDGVEVFVVGFV
LPSAETDMCVPNSSSGWLGSVVYLGMMVGAFFWGGMSDKVGRRQCLLICMSTNGFFAFLS
SFVQGYGFFLVCRLVAGFGIGGAVPIVFSFFAEVLSREKRGEHLSWLCMFWMIGEIYASA
MAWAIIPHYGWSFSMGSAYQFHSWRVFVVVCALPCVCAVVALTFMPESPRFYLEVGKHDE
AWMILKQIHDTNMRARGQPEKVFTVNRIKTPRQLDEFVEMESESGNPVSKAFFRIKAEVR
GIYLNLMKCFNYPMRENMLRLAIVWFTLSFGYYGLSVWFPDVIKHLQADEYASKVKIHNN
ERIEGITFNFTLENQIHKNILFINDHFVNMKLKSVTFIDSTFRNCYFDDVTSVGSFFRNC
TFIDTFFFNTDIDESKLIDGTEVINSTFTHNKTGCQMTFDDDYSAYWVYFINFLGTLAVL
PGNIVSALLMDKIGRLSMLGGSMILSGISCFFLWFGTSESMMIFMLCLYNGLSISAWNSL
DVVTTESFPTVRRGTGFGFCNALCKLAAVLGNLIFGSLVGITKAIPILMASSVLVGGGLV
GLRLPDTRANVLM
Download sequence
Identical sequences I3KGR1
ENSONIP00000020306 XP_003459891.1.78416 XP_019221179.1.78416 ENSONIP00000020306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]