SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KIE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  I3KIE4
Domain Number - Region: 173-367
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000183
Family Galactose oxidase, central domain 0.05
Further Details:      
 
Domain Number - Region: 16-99
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000288
Family HBL-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3KIE4
Sequence length 402
Comment (tr|I3KIE4|I3KIE4_ORENI) Olfactomedin-like 3a {ECO:0000313|Ensembl:ENSONIP00000020889} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100705822 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MKLLFALLISTAWTFTGAQYYYQGLMDYLENRLLAIEDRMQLWHEQSHRYHTEMKDFKKL
TAEAMDGLKNHHSMLFKDLEGAAARVDRVEQEMDYVETQMSPRACTNRADKVVEQDAWEL
EESRGEEEEEEEWEELQSRVSDCVEIISGIRSVKIMKRVGSPKGMWTRDPRSSKVYIFNG
TSGNTIYQFKSLLDFSRSLGVTGSRSIRLPSEWSGPGSAVYNGYLYYIKQEAEADMQVVK
YDLLSGSVTETAMFPVEGRATVYNLNPETVADLAADDGGLWLLYAPSDSEPTISLAKMDA
ATLDIEQIWDTRCPRENAEAAFVVCGTVYVVYNTRLASRSRVQCVFDVNDMVLSEEAPLI
YFPRRYGAHASLKYNPEEKQLYGWDDGYQIIYRLTMKRKLLA
Download sequence
Identical sequences I3KIE4
ENSONIP00000020889 XP_005448459.1.78416 XP_013129794.1.78416 ENSONIP00000020889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]