SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KIL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KIL7
Domain Number 1 Region: 311-521,561-610
Classification Level Classification E-value
Superfamily Kelch motif 6.93e-44
Family Kelch motif 0.00091
Further Details:      
 
Domain Number 2 Region: 47-158
Classification Level Classification E-value
Superfamily POZ domain 4.19e-34
Family BTB/POZ domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3KIL7
Sequence length 652
Comment (tr|I3KIL7|I3KIL7_ORENI) Si:dkey-260j18.2 {ECO:0000313|Ensembl:ENSONIP00000020962} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100692633 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MNAVRGGTVTWRPQPWQDGDGGGGEPLSDSDSEEEDFPDDSTTPLGDYITHGLKQLLDAQ
QLCDVTLLVEGKKFMCHRVLLAAVSPYFRAMFTSPLVESRLTEIRLEEVTPSVMETIIQF
VYTGEAGLSLDTAEDLFVAANRLQVMPLQDLCSRFLFEHLSVDNCLGMYSLARSHHDQLL
LRASLRLVAQHFPRVARQKDFLLLDHGTLGSLLSSDRLGVDSEAEVYDAARRWAEHQPLD
RYAHMPALLHHLRPGLLSQEESRRLSQELGPAAAGEGLGGPLRPREGMFEKKIVCVDLTP
REDEYLAARDYTVDCFDPRTGKWEKLAPLGSLVSPGCTAVGDRLFVAGGILRTGSVSAAV
HEYDAVLDRWIEQPSMVQPRAMLGLLGCGESLYALGGSNRSALLDSSETLDLTTLQWSPG
PRLPLPLRAFACAALRGRLYLLGGTTLEQNRAVVHSGVFIYHTLTDCWTRVALDSGATCL
AGGVAVRGGVCAIGGYMRDTTKFLDGNYTNLETLDATGRVLFFREGRGSGVEREVTGGGV
LVSAEQRGGAGGGSDRAPSPVVFPGLPRRIAAGGVARWKRRIYVLGGENGSRFYDSVYCW
KPGWRSWVQRREKLPGDTGGVSQFGCTTLKFPKKHILSRLRLAKENCKKPSD
Download sequence
Identical sequences I3KIL7
XP_003449320.1.78416 ENSONIP00000020962 ENSONIP00000020962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]