SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KJC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KJC2
Domain Number 1 Region: 505-692
Classification Level Classification E-value
Superfamily Sec7 domain 2.35e-65
Family Sec7 domain 0.00000614
Further Details:      
 
Domain Number 2 Region: 720-844
Classification Level Classification E-value
Superfamily PH domain-like 7.39e-18
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3KJC2
Sequence length 944
Comment (tr|I3KJC2|I3KJC2_ORENI) IQ motif and Sec7 domain 2b {ECO:0000313|Ensembl:ENSONIP00000021217} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
IWLLLCLSNKVSGLALLEISISVEGESQCPETGTHKDTSFSQTPYLRGSERYSDSSSNAP
SGSRGPSCVTASSSASLAWALRTRHQPASLALRKQEEEENKRCKALSDSYELSTDLQDKK
VEMLERKYGGSFVSRRAAKTIQTAFRQYRMNKNFERLRSSASESRMTRRIILSNMRLQYS
FDERQPQQQAQTQTNFTHSVAVGPPHSPDPDRTGDYTHLEDSFSKQVKSLADSIDDALTC
RAGRDDSQEGSKEERGRGAGGGLSMHGDSTATSYSDVTLYMDDGMPSSPLSLDRAPSSTD
TEYWGPSGGVGGREDSRDTEGGGSSNSRRSTPCTECRDYRLRGAHLPLLTIEPPSDSSVD
MSDRSDRGSLSRTLVFEQEPGVGAGSPQGTLKHSPNTGTRTTSTAAAQGQTRAPGRPIPT
HIPHQVAAHHHPLPPGGLEQPCCSDGDNDSLNSTTNSNETVNCSSGSSSQDSLREPLPPL
GKQTYQRECRHSWDSPPFNSDVVQRRQYRIGLNLFNKKPEKGIQYLIERGFVSDTPVGIA
RFILERKGLSRQMIGEFLGNRQKQFNKDVLDCVVDEMDFSGMDIDDALRKFQAQIKVQGE
AQKVERLIEAFSQRYCVCNPTLVRQFQNPDTIFILAFAIILLNTDMYSPNVKPERKMKLE
DFIKNLRGVDNGQDIPRDLLVGIYQRIQKWELRTNDDHVSQVQAVERVIVGKKPVSLSCV
LSLPHRRLVCCCQLYEVPDPNRPQRTGVHQREVFLFNDLLVVTKIFQKKKTSVTYSFRQS
FPLVEMQVHMFQNSYYPHGIRLTSAVLGGERKVLIVFMAPSQQDRTRFVSDLRESIAEVQ
EMEKYRVESELEKQKGVMRPSLLTGGVVGGGVGVKSDVVNGTLGRTSFDDNCSVGEGLKR
TALSSSLRDLSDTGKRGRRNSVGSLDSTMELSPLTPPSTPGSLS
Download sequence
Identical sequences I3KJC2
ENSONIP00000021217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]