SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KL10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KL10
Domain Number 1 Region: 369-538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-47
Family SPRY domain 0.00058
Further Details:      
 
Domain Number 2 Region: 8-79
Classification Level Classification E-value
Superfamily RING/U-box 2.65e-17
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 3 Region: 143-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000519
Family B-box zinc-binding domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3KL10
Sequence length 549
Comment (tr|I3KL10|I3KL10_ORENI) Uncharacterized protein {ECO:0000313|Ensembl:ENSONIP00000021805} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MAQQVIELDQEKLSCSICLKLLKDPVTIPCGHSYCMTCIKNCWNEKETHSCHRCRKTFTS
RPVLVKNTILCELVEDVKKAGLPATSSDHAYAGPGDVACDFCSGRKRKASKSCLVCMASY
CEHHLQPHYNVAPFKKHKLINDASKLQENICPHHDEVMKIFCRTDQQCICYLCLMDEHKD
HETVSAAAERAERQKGIETNRQSVQQRIQNREKDVKVLQEEVKAINLSTDKALRQSEKMF
KDLISLVQRKSSEVKQKIRSKQKAEQKRVKELQEKIEQEIRDLRRRDTELQQLSLTEDRI
SILKKRRTLRSISVSQDQPVAHSLEPLGGLSGTEGETHSELFPQSEFLKLRDKINVIKVV
LSFIDPFTRGKFLKYSCQITLDPNTAHTLLSLSDSNRKVTLMSRNQSYPSHPEKFLDCRQ
VLSREGLTGRCYWEVKCNGMVGVAVAYKDIDRRGTREECGFGLNDKSWALTVSDRSYEFK
HNNIPTPIPGPLSSRIGVYLDHRAGTLSFYSITETMNLLHRVQTRFTQSLYVGLWLPQSA
GHTAEVCEL
Download sequence
Identical sequences I3KL10
ENSONIP00000021805 ENSONIP00000021805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]