SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KLP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KLP0
Domain Number 1 Region: 1-228
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.27e-75
Family BAR domain 0.0000000197
Further Details:      
 
Domain Number 2 Region: 261-332
Classification Level Classification E-value
Superfamily SH3-domain 6.96e-23
Family SH3-domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3KLP0
Sequence length 336
Comment (tr|I3KLP0|I3KLP0_ORENI) SH3 domain containing GRB2 like 2a, endophilin A1 {ECO:0000313|Ensembl:ENSONIP00000022035} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=sh3gl2 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
QRVSEKVGGAEGTKLDDDFTVMEKRVDTTARAVMDIITKTTEYLQPNPATRAKMSMMNSM
SRIRGQEKGPGYTQTEVILGEAMQKFGRDLGEESNFGLALIDVGEAMRELGEVKDALDME
VKQNFIDPLQNLHEKDLREIQHHLKKLEGRRLDFDYKKKRQGKVTDDEIKQALEKFDDSK
EIAEQSMFHLLESDIEQVSQLAALVHAQVEYHTRAAEILTQLTSKIDERIKDTSIKPRKE
FVPKPRTSMDFSINLSQNGGVHSARSPARSPAPMDQPCCRALYDFDPENEGELGFKEGDI
ITLTNKIDDNWYEGMLQGNSGFFPINYVDILVPLPH
Download sequence
Identical sequences I3KLP0
ENSONIP00000022035 ENSONIP00000022035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]