SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KLU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KLU5
Domain Number 1 Region: 395-565
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-52
Family SPRY domain 0.0004
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-18
Family RING finger domain, C3HC4 0.02
Further Details:      
 
Domain Number 3 Region: 143-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.33e-17
Family B-box zinc-binding domain 0.00067
Further Details:      
 
Weak hits

Sequence:  I3KLU5
Domain Number - Region: 217-298
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0497
Family HBL-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3KLU5
Sequence length 573
Comment (tr|I3KLU5|I3KLU5_ORENI) FinTRIM family, member 82 {ECO:0000313|Ensembl:ENSONIP00000022090} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100708751 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MADHTSPDYFSCSLCQNLLRDPVAIPCGHSFCMDCISGYWNEADYTGIYICPQCKITFTQ
RPVLRPNATLSMVAEKIKKSGLNLNLSTSQGSVFAGSNDVPCDFCIGKKLKAVKSCLNCL
ASYCEKHLKPHYESTTFKRHKLVDELGNLDRKICPQHQKSLELFCRTDQMCICAICTVSE
HRGHDIVSAEAERGEKQKLLGVSQAEIKQKCQERVKELEELKTAVDSLKNSAHRAMVESQ
KMFEDMIRSIERMRSEVSKLIGINEKAAFSQSEALIERLEQEIDELKKKESGLKQLYSTE
DHIHFLQNFNYLCTPTDDGFIPRVTVNPDFSFAAVRKAVAEIKERLEEFGREELLRISKS
VNEVPVYTTESRTLDRRSRGKEMTVDNTPPEPKTRADFVKYFCQLKLDHNTAYKELYISE
NSRKVIRTRELQPYGDNSERFDSFAQVLCREALSGGRFYWEIEWNGEFSIGVAYKSISRK
GKGSLCLLGYNDKSWSLLCSDSGYSAWHNRVDKPANGPHSPRIGVYLDHTAGVLAFYSIG
NTMTLLHRFETKFVEPLYPGFGVGTSVRICNVK
Download sequence
Identical sequences I3KLU5
ENSONIP00000022090 XP_003458081.1.78416 ENSONIP00000022090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]