SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KN74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KN74
Domain Number 1 Region: 505-632
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-31
Family Nuclear receptor ligand-binding domain 0.00000544
Further Details:      
 
Domain Number 2 Region: 420-499
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-25
Family Nuclear receptor 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3KN74
Sequence length 633
Comment (tr|I3KN74|I3KN74_ORENI) Nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor) {ECO:0000313|Ensembl:ENSONIP00000022569} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100534398 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MDKGGVKKIAYRRDDHLSKLVYTESPEEGGLLRVAPHSAMSVTSPASVVLPSSSLMQPGQ
VPNGLNNSPLPEELTSASVIATVGSLIDGPEPRGLTKDQRPQHQQQLLQTQTTFGHQTLS
ENLSQLDASMADITQSSMDSLIGGSDPNFFHLKTEDFSLDKGEQDPIDLDNAFEPIGKDM
DVNQKLFSDNTLDLLQDFDLTGSPSDFYVGDDAFLSTLADDSLLGVTSERDIKPAVVDSS
NTTGAVPVALNGSSVTNPAQSSPTISTTTSLSPETTLSAMVKKEKDANFIQLCTPGVVKQ
EKTGGQSYCQISGTASGDMAGTNAVSVCGVSTSGGQTYHFGVNPLSSDSQLQNEQKPVSS
LFLPVTTIGGVWNRGQGVGNNSLVQRAGEGFSGSPSYPTSFTRQEGSTATSSTQGKSGTH
KICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRF
RKCLMAGMNLEARKLKKNRLKGVQQSNPPEVAPSPPVETRSLVPKCMPQLVPTMLSLLKA
IEPDTIYAGYDSTLPDNSTRLMTTLNRLGGRQVISAVKWAKALPGFRNLHLDDQMTLLQY
SWLFLMTFSLGWRSYQQCNGNMLCFAPDLVINE
Download sequence
Identical sequences I3KN74
ENSONIP00000022569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]