SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KNT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KNT7
Domain Number 1 Region: 426-600
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-47
Family SPRY domain 0.00037
Further Details:      
 
Domain Number 2 Region: 177-241
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000168
Family B-box zinc-binding domain 0.00057
Further Details:      
 
Domain Number 3 Region: 17-58
Classification Level Classification E-value
Superfamily RING/U-box 0.00000825
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3KNT7
Sequence length 626
Comment (tr|I3KNT7|I3KNT7_ORENI) Tripartite motif containing 16 {ECO:0000313|Ensembl:ENSONIP00000022782} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=LOC100693358 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MADTAAVEVAPLPKQQQQQNLCGVCSGKPSGEEPAACGHSVCGSCLEGKSKGCPQCPVKP
GSPKQNGTADPPVNKTSENQSQESKTAEETKIQEDLKESEDPKKPEEDKKEAEPQTEEGP
KEDQDKEEPLGPDDVVCDSCIENPRRALKSCLTCLVSYCEAHLRPHLENPKFQNHRLVDP
LRDIERRTCESHKWPLDLFCSTDSCCICQDCVNEDHKGHNTVSVVEARNQIENELREKQT
EMMKTVTAAENAINKLQLNTVSIEQSVKDVRAVIESQFEELQAVVEKAKKEVTEILEGEE
KQALQQAEGIRVHLEQRCTDLKKTQVQMEKISKNKNDVDFLQEYAEWKKEAADISLPGVY
IGLMDCLNAFSRVIVDSTQELCAMLVSSYIDKVKETCKSDKVGIKTTVKAIAAAKYIKSL
PDPVTRADFLKYAAQVSFDPVTAHKFLRLMEENKKVTNTTPWQHPYPDVPERFENWRQVL
AVESFYMGRHYFEADIHGESTHVGLTYKSLDRKGNESNSCITGNSFSWCLRWNGRNFSAW
HCDVETPLNVEMFSRIGVYVDYTQGLLAFYGVGETMTLIHKYQTEFLEPLYPAFWLPKKE
NTVLLVAPGEPLPPKTPSPPTSPTTE
Download sequence
Identical sequences I3KNT7
ENSONIP00000022782 ENSONIP00000022782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]