SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KPF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KPF3
Domain Number 1 Region: 4-86
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.49e-18
Family PB1 domain 0.00013
Further Details:      
 
Domain Number 2 Region: 215-262
Classification Level Classification E-value
Superfamily RING/U-box 0.00000033
Family ZZ domain 0.016
Further Details:      
 
Domain Number 3 Region: 915-952
Classification Level Classification E-value
Superfamily UBA-like 0.000000365
Family UBA domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3KPF3
Sequence length 961
Comment (tr|I3KPF3|I3KPF3_ORENI) Neighbor of brca1 gene 1a {ECO:0000313|Ensembl:ENSONIP00000022998} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN= OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MGLPVTIKVNFRGNVKRFLAQDMDKLEWEAVEVWIKASFGINHFQVKYFDEDNEEICINS
QDEYEEAIKSAEKQGNQLHMNVYKMKGQACGGPLKTEVKELKGDLRPAPPYPSRVKTVDK
GTQVTPEREAVAVKDNKGNKPDDEPPPMWFRSYMEKFKDEVVKEVVERMCSDFSVQCCTH
KSPEGPPEAIGAIGGIMGPKPGPSTSNGSLGYTPNCSSCNKLTSEGAYKCSVCPSCILCE
MCRHSHDPSHNLVRTKTPLSIPEHGMSENKHSIVHKFPRRGDRTVRKAERQRLKAERRQL
RAEVKEIKKKLRLEKRGLQWSGPSTMDAKKSFFPRKEIMLCTLETRGPGVSHTSLVPTMA
ALFLDENLPDGTNLEPGTKFIKYWKMKNTGSICWTSETKLVFMWGNLSLASEEKREVPVP
LLPPGHVGMVSVALVAPVTDGTYTSHWRLAHCGSQFGPRVWCSIVVKQRDKRTGLRHQRK
RLAITACSLEDANICAKISVLLSELHDTNDGTLVCPSEERSKTTEGRDYYFPPVDFMTAQ
DLLSFELLDLNFADDLEKVPHNTPADLTPCISPLPYCTVVLDKSSPSPKKEETEISGVRK
LFGRKLRNLKEVFTPVAQEEERDDEISGAQFLCETVMRSLALEEAPDHRPPRRLQRCCHE
PKDHNNEDKNFEVCDGTQNVTDDREEKEEDGNKGEDWDEESLYRNSHVIISSYSSLVPQI
SSQISSVSSDDYSVILPDCFDTSRPLGESMYSSAMSQPGTGAADVASDKSDVEQEEEEDS
IMERGSQINSSVNQMLCASQTVDEVTLNPEVVPSPDPLLPPPALYSPRLDGEHIWMSEAL
YLADDPSSPACDPNEPHQPRVHLNGEYYCHRGQGGITEGLVKGALSVAASAYKALFTGPS
CSVERGIDPATTQGPSKMDQLLEMGFRDQRMNRRLLKKHFYSLEHTVDELVQLAENRRNR
Y
Download sequence
Identical sequences I3KPF3
ENSONIP00000022998 ENSONIP00000022998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]