SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KQT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KQT4
Domain Number 1 Region: 541-587
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000314
Family TSP-1 type 1 repeat 0.00085
Further Details:      
 
Domain Number 2 Region: 120-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000038
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 3 Region: 57-106
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000051
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 497-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000317
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3KQT4
Sequence length 588
Comment (tr|I3KQT4|I3KQT4_ORENI) Uncharacterized protein LOC100693988 precursor {ECO:0000313|Ensembl:ENSONIP00000023479} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=c8b OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MLSMVIQSSAINLHSCLLHVTLSLVLLSNVAVATGSNEDPSSRQARSVGDPVVIHPVDCI
LSEWSAWSRCDICQKRKYRYAKVEQPSQFGGEQCNSHAREEEACNVPARYTCDSVPLCEG
FLCTQTGRCIPRTLQCNGEDDCGDMSDEDGCRKVPKPCRQEAEEYWGIENLAKGINILNS
NLEGVVLDNRYYAGSCLPHYIQDVRFRKPYNLQQYTFQTRGSYDFSLQAFESYSDYMDYT
MKERMSKTVVSFGFGIPGIVEFGFNYNDNKYSKSVKKLRSASGKTNSFVRAKAELELAQY
MLKTDDLMLHPEFLRRLRSLPQAYDYGEYRQIYRDYGTHYVTEAALGGDYEHTIILDKEK
LAKTEYSLEDYKNCVQAGLKVGANIFGVYVSVGFHGGSCDGLLNEMGEEKGTESEVEDFV
AIVRGGSSESISALLSKKLPTPELMRLWGEGVRFNPDFIRQTTRPLYELVTSRDFSHHAI
LKRNLKRALSEYLAEASPCRCAPCRNNGVAVLKGTKCDCVCPVGYTGRACEITNRKKEIA
IDGNWSCWGAWSSCSGGQKTRSRQCNNPLPSNGGMACTGLQQESTACF
Download sequence
Identical sequences I3KQT4
ENSONIP00000023479 ENSONIP00000023479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]