SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3KQV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3KQV3
Domain Number 1 Region: 136-413
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.7e-73
Family Protein kinases, catalytic subunit 0.000000002
Further Details:      
 
Domain Number 2 Region: 409-462
Classification Level Classification E-value
Superfamily SH3-domain 0.000000002
Family SH3-domain 0.0021
Further Details:      
 
Domain Number 3 Region: 1073-1118
Classification Level Classification E-value
Superfamily UBA-like 0.000000268
Family UBA domain 0.077
Further Details:      
 
Weak hits

Sequence:  I3KQV3
Domain Number - Region: 7-69
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0408
Family SAM (sterile alpha motif) domain 0.0088
Further Details:      
 
Domain Number - Region: 1119-1157
Classification Level Classification E-value
Superfamily UBA-like 0.0608
Family UBA domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3KQV3
Sequence length 1164
Comment (tr|I3KQV3|I3KQV3_ORENI) Tyrosine kinase, non-receptor, 2b {ECO:0000313|Ensembl:ENSONIP00000023498} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=tnk2 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence
MQCEEGTEWLLELLMEVQLQQYFLRIRDDLNVTRLSHFDYVKNEDLEKIGMGRPGQRRLW
EAVKRRKAMCKRKSWMSKVFSGKRPDGGDVPQQGQPASSFRKLSPTPPLGVGEGVLVTQP
SGGALLDGQQQGLTCLIPEKDLTLFEKLGDGSFGVVKRGEWLTPAGKVLNVAVKCLKTDV
LSQPDALEDFICEVNVMHSLDHQNLIRLYGVVLTHPMKMVTELAPLGSLLERLRCVRPQG
PVLIHTLCQYAVQVACGMAYLEQRRFIHRDLAARNILLAAAHRVKIGDFGLMRALPNNHE
HYVMQEHRKVPFAWCAPESLKTRTFSHATDTWMFGVTLWEMFTHGQEPWLGLNGSQILHK
IDKEGERLPKPEDCPQDIYNVMLQCWAQKPDDRPTFVALREFLLESMPTDMCALQDFDEP
DKLQIQVDDIITIIEGRAENYWWRGQNKRTLKVGQFPRNVVTSVAGLSAHDISRPLKNSF
IHTGHGDTNPHRCWGFPDRIDDLYLGNPMDPPDVLGLDLSAAQPTQLAGRAKKPSYDPVN
EEEDLTSAGLKRLSLRKTGSVKGLKLKPAVWVSASKQGGGRTSGSGQNTNSEVSLIDFGE
EYPISTPSPSPVVEIPIPLLAKLALEAENLLDRTPPQSPSKSLPRPLHPTPVVDWDARPL
PPPPAYDDVAQDEDDMEVSSINSSEQQNEAEHSDGLNPEETLSSGQKVNDEALVSRGSDR
PGLEDNLFLPSNHSQGLSTSFSQSAEIFQELQQECMRRLNVPAASAPRSCSPLQSSVLCP
QTLQSPQTHEGQQQSVLSCNEDRPQIPPRVPIPPRPMKKGDYTSGRWSRDLSLSPVPTET
TENVSGAGQERPPQIPPRDPLSQPGSRTPSPMGLVVGSPQQRLYSVSPNTMQAAITTCPP
THTYSSYLSTSPGKLMPTTHSFASDPKYAAPKVIQAQVQGKDAASKGPCILPIVRDGRKV
SNTHYYLLPERPPYLDRFDRFFREAESLPANDVEEKHVRQANTATVRPMVVGSHTLQGHT
QVQVQPGGDLKANFSSNNNSNLGWPRSGMKSSVSLPRVCSDGLTAPAVTAFCTRTDGGAN
SADRVKMVQEAVHGVTMEECQAALHNHNWNVQQAVHYLKVEQLFCLGLRSRSECLKLLEM
CDWNLEVASTHMLDNYGSTTRQRR
Download sequence
Identical sequences I3KQV3
ENSONIP00000023498 ENSONIP00000023498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]